CAZyme Information: PIW_T011106-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T011106-RA-p1
• CAZy Family: GT20
• CAZyme Description: 3-deoxy-D-manno-octulosonic-acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		38876.78	9.4241

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC02835:1523-3019(+)

Full Sequence      

MTTIALVVTHAYCGAWRAAAPLLTWYIKRKDLRRGVLPALTAERFGCSKPPASMYHWTMD
SLASTLCAAEWRQRTNDDEYFTLWIHGASVGETLSALPLIELVLSDAFLSSANSYRGGKK
KTKTRVLLSTTTPAARRLLSERLAAVANNSNALCIFAPLDHPDWVCRFFETWRPDAGLWI
ESELWPNMILEAAKRQIQIGVVNGRLSERSFQRWRLPVLRQFATSLLQSFSMVLCQNEVN
EQRFKALGASTTDVLTNLKFATKQQVGCDESQVVQLQNAIAGRHSWVAVSTHEGEELQIA
EAHVQLTKSLLPPNKFVVTIIIPRHPDRTPAIAAEIQRRVSYYLVS

Enzyme Prediction     

No EC number prediction in PIW_T011106-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	79	261	5.9e-46	0.9209039548022598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	1.58e-67	83	339	53	285	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.37e-65	11	339	4	283	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	5.98e-56	83	261	16	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK39579.1|GT30	4.77e-54	8	333	2	276
BBK34513.1|GT30	2.27e-50	8	334	2	277
BBK45120.1|GT30	6.38e-50	21	332	15	276
QKK05982.1|GT30	7.68e-50	12	334	5	276
ABS62248.1|GT30	5.17e-48	11	336	12	286

PDB Hits     

PIW_T011106-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1RGU8|KDTA_RICBR	6.39e-33	78	332	46	273	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q4UND5|KDTA_RICFE	2.05e-30	83	332	98	320	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q8VZA5|KDTA_ARATH	6.05e-30	83	338	57	293	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q68XV7|KDTA_RICTY	9.90e-30	83	332	95	317	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	2.55e-29	83	332	93	315	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PIW_T011106-RA-p1.