CAZyme Information: PIW_T010651-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T010651-RA-p1
• CAZy Family: GT2
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471		51098.63	6.4071

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC02522:1-1703(-)

Full Sequence      

MAHCSPASLVFAAAMLASSANSSLAPLQLQDANVTIAPKEDFQLFDALSTEAPPQSLFPY
TNAHSTFLPPRFLAPGIVGSKAVPTNNWWGNMIAATTDAPVQPAWVNPYTVRPLIVSAPF
GLSFSYPYPTRGYGGSTGNGNANRFYLHGVLEEIVFSAVEFTTAPTFEIFGWDDLSVQLR
FTKGAGKFESTLVSGMPFATAKYTALTPSFSTQFAIISVNGQAAVSGLITTSDRFVLELN
NGQRWTLYFSSSVSLKVNGMSTLTGLTQFTGTSRVALIPSADKQSVFDQARFCVLEGGDV
EARDESTYSYNWKTSGNCGGGLLHYAQIHHVDTLDRTSAAEAGGIEAYSTTRGKMTALLT
KTSPPVWRFTDSVVIPVDFYPPRKPSASVKYASLCLMANDASVVGSDTQLRAECVAKLKI
ILTPFLENTWTYRLSYDTVYRGILSSQGFALNDINVDFGNTMYNDHHFHYG

Enzyme Prediction     

No EC number prediction in PIW_T010651-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	80	471	9.7e-72	0.594855305466238

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	6.38e-47	5	471	30	515	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.27e-45	80	378	12	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
407548	Glyco_hydro81C	2.47e-25	390	471	40	117	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	3.61e-159	35	471	69	553
UIZ20868.1|GH81	1.13e-118	53	471	90	553
UIZ20873.1|GH81	1.13e-118	53	471	90	553
UIZ20872.1|GH81	2.24e-118	53	471	90	553
UIZ20875.1|GH81	2.24e-118	53	471	90	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.12e-33	81	471	39	481	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.26e-33	81	471	64	506	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.85e-31	81	471	39	481	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.33e-30	83	471	35	463	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.07e-26	76	471	224	660	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.73e-23	44	471	402	869	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.31e-20	39	471	42	498	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	9.57e-18	44	471	428	898	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.404272	0.595712	CS pos: 23-24. Pr: 0.3127

TMHMM  Annotations     

There is no transmembrane helices in PIW_T010651-RA-p1.