CAZyme Information: PIW_T007115-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T007115-RA-p1
• CAZy Family: GH5
• CAZyme Description: Trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869		98624.65	5.0556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC01119:7303-10140(-)

Full Sequence      

MPLATAELGESSLLDQLHDLHRRLAAVRQDSQRYNSTSRNVGPIPMASESNKIIVCSLQR
CVRMVKTSQDDSWQYIPSDAGFKSAIDYLCEGNNVQWISWPGAVVDESSQDGVRRKLESE
YNCRPVFLTSEMLDLYHNQFCNVILWPLFHSLPQRSDSRLLENFAEKYEAYCGANQKFLE
AVSEIYKDGDLVLVCDYQLMNLPGLLRRRFPDITCGFYFHSPFPSSEFFQMLPAREALLH
GVLGADLVVFNHFDYIRHFLNVCTRMLGLESSPSRVEYNGRLISLGICPMGIEPLKYEIT
PSVETQIQMLLKQHEGMKVIVGVHKLDFCKGIPEMLEAMEYLLQHYPEYRGKVVLFAVVR
EAGRTASYQYQMLNRQINELVGRVNGKFGTAEYTPVRYLQRTIEHDQLVALYNTADVGII
SSIKEGINLQAMEFIAAQKESCGGVLVYSEFAGCASSFQGALLVNPMHIEQVAASIDTAL
KMSTTTKRIRHHQLSRYVNTYTSTLWAQRIMSALNEAAATAQEYNRLEKLDTAQLLGYYE
RSQRRLFLLDYDGTLVNYQSMAELAGPSPALLSCLEELSADPHNSVYIISGRNKSRLQEW
FGHLSRVGLAAEHGYWFRPAAKHPLSAFKTEESDEKISSDSTSNNSADDGFDELELRGNA
EDNEELLGDDSALAMADASTGDGHLESLPWQCMFSDVELEWHDEVESILEHFTERTPGSL
LDIKDCMYTWHFRDADPTFGLKQAKDLQLHFDQMLRDRPVGIVMCRIKKYVTIRPWRVNK
GRAVSRILEYESETPYFTSLDSDFILAVGDERTDEDMFNVVQGSNCYTCTVGHKVSRAQY
YLDDPDEVLRVLTAMTSLQSSTDRQALSV

Enzyme Prediction     

No EC number prediction in PIW_T007115-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	49	515	1.2e-148	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	70	857	18	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.10e-172	52	515	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	4.84e-158	70	516	21	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	3.26e-152	70	862	112	933	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	1.80e-150	66	862	25	790	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29132.1|GT20	0.0	2	868	9	875
CCA19773.1|GT20	0.0	5	867	21	923
CCA26754.1|GT20	0.0	5	867	21	923
AJA04606.1|GT20	3.66e-171	4	868	59	889
AGT80036.1|GT20	3.66e-171	4	868	59	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	7.95e-120	65	519	25	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.02e-113	65	515	13	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.39e-110	48	519	7	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	9.50e-106	52	514	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	3.67e-105	52	514	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	2.56e-164	50	848	15	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	8.16e-135	70	861	85	840	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	1.08e-134	47	862	56	846	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	4.23e-134	83	856	81	788	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O23617|TPS5_ARATH	2.26e-131	35	866	44	854	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PIW_T007115-RA-p1.