CAZyme Information: PIW_T006367-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T006367-RA-p1
• CAZy Family: GH47
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1200		129882.57	5.1422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00931:5150-8844(+)

Full Sequence      

MRSLFSAAASAMLLLLAAPSATRVALAIPDAGAQLKTPLPFPIESHPFQLNQELFAADEP
VPAVPASTSTTAAASSSPASGNGARVSADLSGKRLADVPFPTGAFWTNLVLEKGESIVTT
LPYAFRLLQGKVHVSYPFRVVMPKVIQNGFISQMVLSSASAASDASHASAPLDHHVVAFD
SFSATVRFSRKQQEEFSLFLVRGSPYVTVEYKNSIPIIEGNEGLTVTRIKKLENQIFMNG
DQVDFAVFTVMLSNGQTWGVYASDPALELELGSDGKISSDKPFTGVLRVALSLDFNVQPF
LLEAAPYYPVGGDVDYTIDAAKNVANLQFKWKTRRFGSKAGDASAASDKLLMLALPHHMD
ILSFDAHSNATVNKVVRDIRYTSIKGMMLGVYGAVWHLQETLPEVEWDFEDDGLFYEDES
RDASKKEAALRKNTRNQVIKDIVAQLHHDVDAYPALAVDSYNFGKQISREARLLLIADRF
KQQELVDKLLSKMKTELGAWLTGTNPDFLVYDQTYGGVVTSDGIRDQGADYGNGHYNDHH
FHYGYFMYALAAVRKFDPAFIASHSLACAMLMGDIGTPILSDTAFLDDFPARQFFPVTRH
KEWFVGHSYASGLFSMEVGKSQESSSECVNAYYALALFSSLDASAQDDNSYHQYTRLLLA
TELRSTKKYWHMQNNSQIYEPLFSQNTMVGVAGEMSVVYSTWFGYKAVYIHGINMMPFTP
ITTQLLNEEYVAYEFALLRQDYQDLEPNDIWRSVVVLDHAIVDAATAWDELVTSISAYDS
WNSASNSMYWIATRQSWFTQKTRNTLTHPDLHNEDQCFGYPACNVAGTNGTALGCCGALP
GCCPSTLGCCPPKDPASVPLNACFGEHQCAMLNLGCCNSIDGCCEPDPFTGGVLGCCKNQ
PITKKPRPTAPRNTTGSAMCYSQPLCAAAKLGCCDIPGGCCPEDGPKLDCCTNKVTPAPA
NAEDAATCQNQPKCAVAKLECCGFADGCCAPDPKTKGVLDCCEAPVLTIAPAPAPTFALV
KSSTFEKDTCFGEPQCALAGLDCCGGPDGCCQPDPVSGEKLLCCTQDANDTTPVPEVAHT
CHGEVACLTGGANGTALNCCFTEAGCCPGLLCCASSGNDGNEIRTKTGASNDDGISKKST
VSLVFAIVLGVIVLGAIIFCLAMCYRRRHYAPIGHDLRAWYCAAMLVVVFGFFVFLVYNA

Enzyme Prediction     

No EC number prediction in PIW_T006367-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	94	790	9.4e-153	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.98e-76	99	791	89	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	2.22e-75	437	769	8	327	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	8.98e-47	91	410	6	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	20	1196	13	1076
CCA18874.1|GH81	1.81e-231	98	902	28	849
CAN97272.1|GH81	4.41e-106	92	794	86	717
AGP40408.1|GH81	1.01e-102	99	794	79	701
AUX36386.1|GH81	6.81e-102	99	794	90	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.83e-47	101	798	42	722	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.30e-47	101	798	67	747	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.03e-45	101	798	42	722	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	5.32e-27	99	778	48	665	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	5.80e-27	99	778	68	685	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	3.70e-45	181	792	126	697	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	4.69e-41	181	768	323	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.61e-38	99	790	460	1133	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.26e-36	97	788	431	1100	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.16e-33	181	769	202	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002417	0.997554	CS pos: 27-28. Pr: 0.4788

TMHMM  Annotations     

Start	End
1143	1165
1177	1199