CAZyme Information: PIW_T004963-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T004963-RA-p1
• CAZy Family: PL3
• CAZyme Description: Glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		64511.12	7.2125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00639:12091-13800(+)

Full Sequence      

MAPPASRAAMRPSLLLFLATLLLSVAFPGCIAMEQPPRALSATSAKSPLLPDEAAFATFF
YDHGDDSDALFLATRVMLKSIKESQTVFRKLVLVPKDGMSAAKAQILQQDDPEIEIVRTG
VSNVFLHTTIVDHRAQLLHMRNKLVIWDDPVVSKLKRVVYLDPENIVLRNLDEIFACTQF
CAVDNGQSIVYSNSLLVISPESIAARNLYSDAIDSFMISGREYNYVGVTQGFLPGLFEAF
EESPLYYFEDDDEEGTADGESKYSSSATNAESVVHRLPFYYSINHMVFYERMNWDLYKCK
DKNTTAGSIPGPLLSYKYSGVTVKPWFWLPYTYFQVFWHWQEFREMLDEDHLGYFIAKFV
SLTIIFSFAWFFYVALCLRLHSEPNGRPRRLSSWNLPAPGNAQPISMDIFNSKAMRKACQ
ISCSILYAVSSMPILSGFVLVLVTMMGSIFSVPALMHPRYACKLWWYLYNLLMVTALLVF
DIAHMFRTTQWKKTEVPSSTVLLLDSLVSCVKKLPVLVIVQFVFLYVVGRTDLFMNPVLR
PVVTFSLLGAVGAVQLRILSKEMERVSRK

Enzyme Prediction     

No EC number prediction in PIW_T004963-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	6.43e-11	55	233	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	6.72e-235	61	568	2	514
CCA23792.1|GT8	1.16e-158	49	567	46	580
UIZ21271.1|GT8	6.75e-18	55	379	38	364
CCA16211.1|GT8	1.18e-17	31	386	21	370
ANM61220.1|GT8	2.93e-14	55	345	64	314

PDB Hits     

PIW_T004963-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	1.74e-14	55	345	64	314	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	2.20e-13	55	328	60	294	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	1.78e-08	53	246	30	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002441	0.997535	CS pos: 29-30. Pr: 0.9363

TMHMM  Annotations     

Start	End
13	32
352	374
422	444
464	486
506	528
538	560