CAZyme Information: PIW_T004421-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T004421-RA-p1
• CAZy Family: GH16
• CAZyme Description: Trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	PiwaDAOMBR242034_SC00535|CGC1	88691.55	6.3455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00535:1919-4498(-)

Full Sequence      

MAPSCSSPRRQYHGTCACVRDEDGGLRCACVFKENANNDDDDVPSDANGHSHKRRRRLSF
EEEDAIDQAQIVRLLGCASWSNLLAAAAHLNEIKENGGNVTATAVLQVEDMCSVCARPRA
ECDQETCMAHRVRALSSMKQKLKRHWKLVAVAVTVVAVFALWLFITLGPSARPSQTLSSP
ESLDVEPKKAKALVKPAQPVRAITPAPGSPPEFPQLGIYGDAEMERVMDIYCRGPILHAV
QMANVFSDSKHFVDMPIKENSSAFDIILDFQHRRLATTEFRPAAGATRRQRKLSHELQLR
DFVNDHFDPPGTELTPITPIDYQELQIPPMIADIQDESLRDWAFSLHQLWRTLGRVPNPR
VRSSYLHAKPVDDPNLRRPQSIMIVPGGRFRESYYWDSYWIVQGLLVSSMKHTARGVVNN
LLEYAAEFGFVPNGGRIYYLTRSQPPMLSDMVKLVAQVGHNATRIEFDDAYLNATVPILE
KEYRFWMQLGPGGHAVEFVRPSLDGNQNITYLLNRYTSSANHPRPESYREDVDVAAEIYG
SGDFNAAETESKKDIRWLGDKLDMKTMLTSCIIPVDLNSIMYRFEKNLETFHEYLGDTER
AQFFRHAAHQRILAMNEVLWSEEHKTWKDFNLETLEHSNIVTVSDYTPLWAKAFGTNDTE
RLQKVVKSLQGSGLLQVGGIQTTNLYTGQQWDAPNAWPPEQDIVIEGLLAVNTKESHELA
RELMQSWVHSSLTAWRQTGLMFEKYNASEIGGLGVGGEYFPQFGFGWTNGVILKFLTIHQ
NLLLD

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	246	777	1.8e-141	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	3.85e-168	231	776	13	541	alpha,alpha-trehalase
395961	Trehalase	1.03e-152	246	779	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	2.96e-87	230	777	55	550	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	1.77e-82	234	776	49	533	alpha,alpha-trehalase TreA.
183936	treA	5.22e-78	169	779	2	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20368.1|GH37	1.17e-278	221	784	168	747
CCA17719.1|GH37	1.01e-235	221	785	118	707
CCA18365.1|GH37	1.01e-235	221	785	118	707
CCA21422.1|GH37	5.59e-232	221	785	156	746
AOW41677.1|GH37	8.28e-229	220	783	40	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	6.10e-92	248	776	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	6.10e-92	248	776	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	4.87e-70	234	778	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	4.51e-67	234	776	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	8.56e-66	234	778	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43280|TREA_HUMAN	1.85e-106	229	776	31	547	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9W2M2|TREA_DROME	1.54e-104	230	779	55	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	7.90e-104	230	776	53	582	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.41e-102	230	776	29	544	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.42e-102	229	777	44	566	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

Start	End
148	170