CAZyme Information: PIW_T003903-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T003903-RA-p1
• CAZy Family: GH13
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1628		181015.94	4.9149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00449:9960-15027(-)

Full Sequence      

MRSGAWLSGAAAAAACVGLLLAPQASARGVSANLTASWPSSPLFPLLETSEYLAEENPAF
FWHFVELLKQQTAVIADTSADVDALADFAVQQALKVAPASKNILELMLATRTYSVKVEMY
RQLGLDSGVRPCGPGTDTWAVFYSQKQCIEAVACSASELGAILAGEKTAAETCIAAGVND
VEMAIDHKYPQSSVPLEKTAILYGAIGTEKFYSFHDKLKALAEANQMQYIARHFAKNSTL
GTLLQGYGVALDIKNMEYKTIDDSKKSVGDDDEDAADLADEDDDQDQDGEEEDVEGFLFN
VLLQRHGEISSEIKQFRDSLVKQDDQDQEIKAWHLKDLGIAAARDIIDAKHPLKRLQALS
QDFPKHAKKLAFSRKPLSDEFRAEIETRQGEALERGLMNKFLLNGIVVDPTQRSFNIFDF
MSTLKEEWSVAKKLAALPLNQSELNTMLSHVRETNSAQQSVRIHVRGPSDGTAPFYLNDI
EKDPKTLQWPSDLDQLRRPAWNIIFVRKNMYEFVVVFDPMASNGRTTLNQIAFMRMRGAP
LQWGLLISSKELMAAKSSDERNVLIQDWKLFNVEDRATAWHFAKLLFLARSKDDEAAVME
ENAGKGGMGRIVSSFIEGVADEGMTEVTVKHLVTSYADATMGVMTRAKLEEEALAVLHED
TYDDLVLSMTDYIQKKHLPLESSLFNGVLQKNVDIQSDIMGHLGRDQALYQDMARLELLS
DDADLVEELLAAQETVPAYFAIFDSNSGEGSTASQNLLSHDSDAKIENLLESHVDYFHAP
ASLLTPKKQTLLFLVDLGNPDHAGHLYEGVKAALEDSDKALRVGVVPRSDSSEDVESTKK
GQLAMSIISAVGTSDDEIHLRFVMDTLSCIVRGKTLDTMKSKLIGILGKLEADDVAKDDA
MLAVLTKIVDSDNVSALTEEKTAGLQQLSTILQGASAPDLSRLYINGFPIDLPSNAISGE
DVTALTGFDSRYRSQAVGRAFVKKSAKLTVEEANKVSLDIVKVCDLVDKYKKTVRAAELE
LEGSQLVVRLPGDSALTVSAYLDPLSEATQMISSLLLMLHNQLNATVEVVLLPSADYAEF
PLQRFYRYLFDKTPSLATPSVEFRKLPIKPILTMKIETPEAWNVQVHQTHEDLDNLRVDP
DSAVDVKATKSAVFRLESLLVYGQCRDKTFDMYAPPNGLQLVLNRDVGATRMHRDTLVMK
NLGYFQLQATPGVWSLHLARGRATELFEIVDMVSDQAMETTPVQVYDFGSRLSQLLVRKR
SGREHDVLLDPNELRKAASEGDVEPIAEDAGLLGSYWGSMMSLLGKKGAKPAKGDNVSAV
AAVAPESVVNRGRTGETIHVFSLASGHLYERFLKIMMSSVLKRTKNPVTFWLLENFLSPD
FKQAIPALREQLGMDIRLVTYKWPNWLRQQTQKQRIIWGYKILFLDVLFPLGVQKIIYVD
ADQVVRADLKELWDMDLEGAPYGYTPFCDSRNVGFQFWRQGYWKDHLRGRPYHISALYVV
DLALFRQMAAGDILRATYDQLSADPNSLSNLDQDLPNYTQHQLKIFSLPQEWLWCDSWCS
DESKAQAKTIDLCNNPKHKEPKLEMAKRVISGKLFPESWVELDQEIKDAEATFVHGSTLA
APATSSTQ

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1338	1583	8.5e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1338	1608	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	7.42e-164	1338	1583	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	8.27e-62	1338	1578	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.93e-37	40	238	1	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	5.17e-25	470	737	9	242	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	26	1613	24	1660
CCA14500.1|GT24	0.0	23	1616	31	1668
AIG56125.1|GT24	0.0	25	1613	23	1505
AIG55512.1|GT24	0.0	19	1613	15	1515
CAB4116261.1|GT24	9.49e-212	28	1607	34	1553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.63e-137	25	1608	6	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.73e-136	25	1608	6	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.73e-136	25	1608	6	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	6.29e-132	1040	1608	660	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	6.33e-113	1338	1608	5	271	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	3.90e-208	28	1624	31	1588	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q09332|UGGG_DROME	2.88e-198	30	1607	30	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	6.75e-194	24	1613	41	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	8.60e-194	24	1613	41	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	6.22e-193	24	1613	41	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999575	CS pos: 27-28. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in PIW_T003903-RA-p1.