CAZyme Information: PIW_T003879-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T003879-RA-p1
• CAZy Family: PL1
• CAZyme Description: Glycosyl transferase group 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		47199.69	6.7609

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00445:10-1266(+)

Full Sequence      

RTSSAAGVRSSDLIETLQDHGFQVLCVSPSRLNEHTELLAREHDVQCVQADANTDTFQKL
LLETSPQLVLFDRFIAEEMYGWQAKKYAPEAARVLDLQDVHFLRKAREFLVKKQGVPFRQ
TLDMRTLDVDAVEKQVVRELAAIHRCDLTLYVSDAEKDALTNRFQVDGDALHCCDFFYPP
PQSADLLPTFTERKDIAFVGSFKHPPNVDAIEWIKAAILPVFREANDDAEIHVYGSYANT
ARYSKLDDAKQGFRLRGFAPNVHDTLRQYRLTVAPLRFGAGIKGKIADSWLVGTPCVSTS
IGAEGMTLPLSAEKTQLQDQWGGLIADEPAAFAAAMQSLYVDEAKWRVAQGAGLEICRGR
YDRERNASALMQRLESVLLQKQTLRRDNWVGKILWSEKFRATEYMSRFIRAKNDKVAP

Enzyme Prediction     

No EC number prediction in PIW_T003879-RA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404563	Glyco_trans_1_4	8.26e-13	193	303	1	107	Glycosyl transferases group 1.
340831	GT4_PimA-like	3.80e-12	6	375	16	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	4.19e-04	31	381	23	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340839	GT4_GT28_WabH-like	0.002	130	299	120	292	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27514.1|GT4	6.30e-188	1	414	257	661
CCA13921.1|GT4	5.26e-144	2	416	54	458
QJQ06155.1|GT4	2.50e-91	2	418	15	429
ATX80913.1|GT4	8.21e-91	3	413	15	409
ARU90469.1|GT4	5.19e-87	3	413	16	424

PDB Hits     

PIW_T003879-RA-p1 has no PDB hit.

Swiss-Prot Hits     

PIW_T003879-RA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PIW_T003879-RA-p1.