CAZyme Information: PIW_T003722-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T003722-RA-p1
• CAZy Family: GH1
• CAZyme Description: Pectin lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		41366.69	8.7412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00419:16934-18142(-)

Full Sequence      

MKLFRVGLLMIAAVLVQTVSAISTGSTPGLAAGTTGGGNTAPVYPTTIAQLKSYLSDSQP
RVIILNKTFDFRGSKGSKTELSCRPLSNRQCLAKNNGFKGQDVILQSGGMANTGGCIEGT
SVAVTYDVAGTKNPLIINDNKTLRGDGLSGVIIGKGLWIQGNNVIVQNIHGGDAIYLQGA
SSGATQERVWIDHVKISLVGRQMMTTNAASCKSLTISNSEFDGVTPYSATCDGRHYWVFI
IEGSATRINLLNNYIHHTSGRSPKFGGLKAVTTDVVAHAANNYWYSNSGFSFEVQSDAHV
LIEGNYFQDTTDPSLHDSSTTGSVLVPTTATQTLCTQYLGRACVANAFSNSGALTGNQDS
TAAARMKGVAVYTPTVAKKITLSTINFDVGNI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	309	9.1e-65	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.06e-27	130	310	7	189	Amb_all domain.
226384	PelB	7.54e-10	97	322	51	290	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.34e-07	103	307	2	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19247.1|PL1_4|4.2.2.10	3.02e-169	1	390	1	396
ACR19251.1|PL1_4	3.02e-169	1	390	1	396
ACR19255.1|PL1_4	3.02e-169	1	390	1	396
ACR19252.1|PL1_4	7.67e-163	22	392	56	432
ACR19249.1|PL1_4	3.19e-152	22	392	56	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.22e-69	24	361	4	326	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.06e-66	24	361	4	326	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	4.74e-65	25	360	5	328	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	4.08e-81	24	380	25	370	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	4.08e-81	24	380	25	370	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.05e-78	17	352	16	339	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q0CZD4|PELF2_ASPTN	2.38e-77	29	359	29	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	9.17e-77	8	368	7	357	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999770	CS pos: 21-22. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in PIW_T003722-RA-p1.