CAZyme Information: PIW_T003115-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T003115-RA-p1
• CAZy Family: GT96
• CAZyme Description: Cellulose synthase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		104260.61	7.5120

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00327:12149-15370(+)

Full Sequence      

MKMESSMNEDTKKAITELTKVDESEALGKISVHGWMHKQGTRKFKGPVAKSWRKRYFALE
GNKIYYFHDFVDCRKYFNSRNDELVVGAIDLRDAFKLEQSERLDLPARGIAIHTRHRVWL
VCPETDSDFTMWFDALEFTIMSTGNGNVVKRELPNVRVYEMKGRFSYRFWYLVFVVTALV
ELAGIVLWFPLGIEPCDMKYKKMTCDIIQQTRSDTIRCGPEPFNGMWNPPHWYKWSSGIE
EVQCFREPVIAHWVSYFMFYLAEFISISLGFLYYLGMWKPVRRGAQYLRDFKPHFPPSKW
PTVDILLCHYSEPAEDTIATLEKIMNLDYPPHLFHVWICDDGYCKTKWADGATVPTVGVN
RGLIEDAGDVRHEVAQFMYERVYESDEVEVDEWRKQHTTVKMPTTSKPRVMGRMDCAVGS
VRDDYDYQGYPKVTFVGRIKPPVHHSKAGNINNVLYNEGACGRYCIILDNDMKPHEMFIQ
AVLPFFFDAPQNSKIARCTAAGCGDIGKICCALCQNAGVPEQQISFCSKDCYNASNHVAS
SLHRRQTQNTVSERMVCSTCNSKINQKKGVCMKCNTPIQRQSSIVNGGNRQFVEVSADDY
SDHVAVNQVGYVQTPQYFEDCLQLRLGDPCGHRNSTFFDSAQTGMDGYECASFAGTNAIF
RREALDSKKSLVDPEWTHPVVELPPPRKINKFMRWVFFMNLTVYPLGSFPALFFFYVTGY
FLYTGNAPIYTSGLRLLMALVPKIVAQSILSALSNRTVENNDVLRSQQTWFSYAFVHVLA
VFEAFYWKITDKEASWANTGALSGNSPMEAPNLLVFLAMVFGCIWSVIRYFVGYNNAETT
HGTPLLFASLFLGGFTASQLGPMVRMSLQTYFGWSHKSLTDQGNIVGSFSLAIVLIVICF
WVYVETPNHQIFG

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	6.45e-13	301	667	1	174	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
214574	PH	8.64e-10	33	140	4	101	Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.
270068	PH_PEPP1_2_3	1.82e-08	30	137	7	101	Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain. PEPP1 (also called PLEKHA4/PH domain-containing family A member 4 and RHOXF1/Rhox homeobox family member 1), and related homologs PEPP2 (also called PLEKHA5/PH domain-containing family A member 5) and PEPP3 (also called PLEKHA6/PH domain-containing family A member 6), have PH domains that interact specifically with PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3 specifically are: TAPP1 (tandem PH-domain-containing protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd- Ins(3,5)P2 (centaurin-beta2). All of these proteins contain at least 5 of the 6 conserved amino acids that make up the putative phosphatidylinositol 3,4,5- trisphosphate-binding motif (PPBM) located at their N-terminus. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
275388	PH	3.71e-08	33	136	2	92	Pleckstrin homology (PH) domain. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
395117	PH	3.36e-07	33	140	4	104	PH domain. PH stands for pleckstrin homology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP96909.1|GT2	0.0	2	913	44	1022
AEZ51040.1|GT2	0.0	6	913	56	1032
AXF53810.1|GT2	0.0	2	913	41	1019
ABP96905.1|GT2|2.4.1.12	0.0	2	913	41	1019
ABP96913.1|GT2	0.0	2	913	41	1019

PDB Hits     

PIW_T003115-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.12e-09	410	487	554	642	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q86IV4|Y4775_DICDI	7.95e-06	34	149	20	125	PH domain-containing protein DDB_G0274775 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274775 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000087	0.000000

TMHMM  Annotations     

Start	End
169	191
253	275
696	718
733	755
768	790
810	832
845	867
882	904