CAZyme Information: PIW_T002767-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T002767-RA-p1
• CAZy Family: CE2
• CAZyme Description: Cell 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		92214.54	5.3334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00273:15977-19032(-)

Full Sequence      

MDETSNYQSIEDAVTSVSTRVVITKTRLKQLMFSAVVIIFVVVGAVTLSNTSHSKKASTS
GPADSPIQSVTRLIPVNTRPSTSAPTAGATTPTSSAPPTNDVPQMTPRPASSPQMTFSPT
SAPGDSSQTFPSTAKGDQEGSGSANSSSGSKSPPGSPNAAADQAGDNPTPSNGSAGLDSS
SGSSGTQPQGSTSLTSQPQGSPNSISQPQGSSNSTVQPQGSSTSQPQGSPSVSSPFATPG
TGSPSLPMTTPPPGSTPSGATSRSTPSTSPQSPGTAFNSPSSPSSVFNPASPLPATTSGT
SPNGAILSSTDPLIAGLGVALPTPGPTPGVLLVAIQQPGTAPSIPRPTPATTKPISPFPT
PKRTTTESSSQPNPTPKRTTTTPRSQRFPQKARSAAERTPTPTSAAPVLQLRPAYLPKAA
IRDGSQVQIDNVGALVDSSPTDFAQMDCSLPNYISKGGKIFAVGPAGETQPFVLKGVNCD
AKVPLGLWSNDNNGTTLFEIANFLTRNNFNSVRLPISIESVLNNSAPNQIFVNKVENLAL
DLQTYMTALQSVIRGLAQHQISVLISLQTLKESSEVDETSEDSYLSAIDTLTTSLCSREY
WNVLGLDLKNEPALSTWGDDSASDFRAEATRLGNRMLDGCPKWLAFVQGNSESEEWTSPT
TGKRYEFDDWWGAGLSRAKEFPVTLSISDKVVYAPHFGSPAMYPSSYFYAEDGVTELPNE
ELQTNIKGAFELMFGNLGKEPVAPALVVGEFGGLYTTDRHPKKTIQRAFEGTVKLIAEAS
GFAGGYVWSLNPESDFDYNFGDDKASQSNQFQEGLLQNDWRTANVPLLEALKALDKMPNL
GKLQCVKKKFRLRRASSEALFSFIFMIFVSSEINRT

Enzyme Prediction     

No EC number prediction in PIW_T002767-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	476	794	1.7e-107	0.9622093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223039	PHA03307	2.42e-12	39	416	53	435	transcriptional regulator ICP4; Provisional
225344	BglC	4.47e-12	458	804	33	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
223021	PHA03247	5.40e-12	60	436	2578	2968	large tegument protein UL36; Provisional
223021	PHA03247	9.60e-12	75	408	2680	2986	large tegument protein UL36; Provisional
223065	PHA03378	3.35e-10	49	405	556	936	EBNA-3B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19804.1|GH5_20	5.97e-117	439	845	102	520
CCA15003.1|GH5_20	3.72e-110	418	845	76	517
CCA25494.1|GH5_20	3.72e-110	418	845	76	517
ABL75349.1|GH5_20	1.29e-109	439	857	210	635
ABC87088.1|GH5_20	1.81e-108	418	845	128	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	1.37e-27	453	822	8	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	1.85e-27	453	822	8	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	5.83e-27	453	822	41	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	7.82e-27	453	822	41	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	7.82e-27	453	822	41	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	6.08e-20	486	836	73	383	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	7.90e-18	486	824	81	381	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P04956|GUNB_ACET2	5.63e-10	603	761	196	373	Endoglucanase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000020

TMHMM  Annotations     

Start	End
31	48