CAZyme Information: PIW_T002338-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T002338-RA-p1
• CAZy Family: AA6
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		48835.30	9.2832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00217:11432-13482(-)

Full Sequence      

MALHTRLLGAALLLRLALIIYGELQDRFMSVKYTDVDYDVYSDAAREMAARNSPFERTTY
RYTPVLAFLLLPNVFVHEAFGKLLFVACDLLAGHVLFQILRLRGLPEKTRCVYDSVWLFH
PFSINISTRGNADSIVVLLVLLTLLLLMRKQLVLAALTYGAAVHFKIYPIVYALAFLVLL
NGQYNKTNAKWSTSCQSSFCFWVQLGALFNRDRVLFGLISGGFFLALTAIFYQLYGFQFF
YEAYLYHLTRTDNRHNFSVYFYDLYLRYGTPSGFGVGLLAFLPQLVSLVTISLAYGEDIS
FALFALTMVFVIFNKYFLWYTAFLPLIFPMTSVRLRWKGALMIAAWFGSELHWLFWAFHL
EMKGENTFFQLWLAGLAFFAVNISILATLMTHHTYSPLFSKGQIVQLVPSDSTDSTSSSK
TKLSKTE

Enzyme Prediction     

No EC number prediction in PIW_T002338-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	126	389	1.6e-82	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.87e-131	19	405	23	430	GPI mannosyltransferase
252941	Mannosyl_trans	8.63e-62	126	390	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	1.57e-135	11	404	12	407
VDD20265.1|GT50	9.12e-118	7	399	6	408
VDC86084.1|GT50	5.22e-115	7	399	20	422
CAG7892072.1|GT50	5.22e-115	7	399	20	422
CAB4116234.1|GT50	2.61e-112	14	403	21	422

PDB Hits     

PIW_T002338-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q500W7|PIGM_ARATH	1.63e-111	7	399	21	434	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	1.21e-98	9	398	23	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	1.21e-98	9	398	23	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	3.03e-98	12	393	33	430	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q4R4E1|PIGM_MACFA	9.61e-98	9	398	23	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999912	0.000094

TMHMM  Annotations     

Start	End
7	24
83	105
126	148
158	180
214	236
273	295
302	324
339	356
368	390