CAZyme Information: PIW_T001810-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T001810-RA-p1
• CAZy Family: AA17
• CAZyme Description: Lysosomal beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778		85140.60	5.6014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00154:729-3144(-)

Full Sequence      

MSIREKVAQMTQMDIYSMVNGDVRDPEKALNMDVVTKYAKAGIGSILNAPFNGRVTDGRT
GWSAAEWKHIIDQIQDVYREHNKAPMMYGIDTIHGATYVRGATLFNQPISAAASFNLDLV
YQMGEIEAKDTLSAGIPWIFSPVLGIAMQPKWARMYETFGEDPLLSSLMGAAIIRGIQST
GKVAACMKHFIGYSNPTSGLDRADNVISDWDLVNHFAPPFLAATRAGVKSAMESYNSING
FPVIASHKLLTNLLRKDMNFTGLLVSDYSEIDRMQQEHHLVPTVADAVRVSLSETSLDMN
MSPNMDDFLGTVEVLVKNGGLPESRLDESVMRILSLKKDLGLFGHESKADYVESVAEVGS
PEDQAVALQLARESVILLENRNATLPMRIDASGKITTRIFLTGPISNNKGYMCGGWSVFW
QGSSNSSYFPNGKTFRDAMFARRSDHVSVEHLDVVDVDGNVSGEEYGKALTLAAESDYTI
VVLGEGNYAEKTGDIANLSLPLGQRKYLRSLTQLKHTKVIVILVSGRPRLLHGAHDDAAA
VLLSMLPCEQGGQALTDVLFGDVNPSAKLPITYPKAEGKILPYFHLVNTMCQPWDECPVE
WEFGYGLSYSQFEYSNLSLNATSVQGASGALRVQVTLTNPSDRDGSEAVLLFVSQKYRLA
AVPEKKLLKRFQKVHLAARMSVQVEFVLTLEDWSYYEPHIGTAGFARHFEAGEFSVSILQ
SWGVEGDHEVPNTDGDLRAEPSRGGGRPEVQESGSSAPGAQRTLAKASSLSATFHVVA

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	81	289	8e-59	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.51e-96	71	718	89	750	beta-glucosidase BglX.
224389	BglX	9.43e-69	1	419	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.26e-60	99	688	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.33e-59	2	336	1	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.94e-36	375	609	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	7.05e-209	2	731	38	755
UIZ27116.1|GH3	2.21e-208	10	718	1	699
CCA27737.1|GH3	2.04e-188	1	742	75	796
UIZ29432.1|GH3	6.40e-188	7	732	42	755
UIZ29613.1|GH3	2.86e-186	7	732	87	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.71e-113	1	722	24	743	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5TF0_A	9.64e-78	2	718	21	736	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z9S_A	2.10e-76	1	721	35	774	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	5.20e-74	1	718	21	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.61e-73	1	718	21	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	7.06e-132	1	718	87	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.97e-112	1	722	46	765	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	6.03e-75	72	718	94	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.11e-73	83	718	103	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.10e-68	86	718	68	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PIW_T001810-RA-p1.