CAZyme Information: PIW_T001244-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T001244-RA-p1
• CAZy Family: AA17
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	PiwaDAOMBR242034_SC00091|CGC1	48469.79	8.7098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00091:24526-26193(-)

Full Sequence      

MDRANAHGEWQVLQFAAASRVAVSLLALLTACIVTPYDTSTHLETGASGSLLGAFANWDG
VYFAHIARFGYDYEHVHAFFPLYPLLMRVLSWALASLGPSIATMASGWIISNVSFVLAAL
WLYRLGRLVLGDELVARRGAYLFCITPSSIFMSTVYSESLMCALSFCGMLYLEQHKRSGR
FAELLLSAVVFGCASATRSNGILLSLYIAWHRLCVSPSPVARPAAFLRFWLVTALLGAIA
VGPQIAYFVYGMRVYCPSLFPSAASSSPLLTTDRTWCADVIPNFSAMYMFIQREYWNVGL
FKYYELKQLPNFLLAAPMLTLSASSLIQFFLLAPVKRTAQRSAANASLETPYYVHWLFLL
VNALLVVHIQVTTRLLCACPPLFWAPAASAILKTRATKDDDTSGPDSSTMTVKGKLVVGY
FVLYNVLGAVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in PIW_T001244-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	12	439	5e-105	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.48e-50	11	439	3	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.57e-13	55	359	71	349	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	1.05e-164	9	439	6	439
CCA18790.1|GT76	8.37e-125	9	439	6	490
BBN03197.1|GT76	1.57e-55	12	439	15	482
ACO67127.1|GT76	2.10e-55	33	439	26	421
CAB4087207.1|GT76	6.39e-52	12	439	20	497

PDB Hits     

PIW_T001244-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	1.45e-41	11	439	10	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	1.91e-40	11	439	10	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	2.45e-38	11	439	10	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q290J8|PIGV_DROPS	1.73e-37	52	439	60	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9V7W1|PIGV_DROME	7.88e-36	52	439	56	449	GPI mannosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=PIG-V PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.050323	0.949673	CS pos: 31-32. Pr: 0.8993

TMHMM  Annotations     

Start	End
12	34
79	101
108	130
150	172
184	206
226	248
310	332
352	369
416	438