CAZyme Information: PIW_T001050-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T001050-RA-p1
• CAZy Family: AA17
• CAZyme Description: Alpha mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976		110402.82	6.4387

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00071:25590-28520(+)

Full Sequence      

MLKLELLWEALLVLFLVLLLRIDSVPSVQLAVASAPTDQSSSLHVLKRQPIELANPDPPL
SQQQQRQFVARNRIRLPLNGSVNTLPLQFACEFAVDNSDEFYRRYKTQLLCIEIDGQWRH
CSPTRNEPPLFANLSPGAHSAVAFLVANEDSDEWLLESESIVFTVLHRQQYQEYVDKRKR
EERERFGIEDDVSLLMWTTSQPRRSTVVSEQQVNAQGDFVEPSLTAVNGISQEDQRLPPP
LLVIGVKTSVLRGFKSRQAIRATWGNSASLDSQGVKLVFAGCQPVISNSHQDKESLFQAI
ATEKQRYGDLLTDELECEDSYFTLPTKVKEFLHFAATKFPQAPYIMIADDDIYLRVDQLT
QALRQHGPRKKFYAGQVWAKQFLSPVVPVRNPNHKNYLPEAQYPMNTLLPFVFGPHYFMS
MDCAEFIGSNRHALVDFTSLDDVSIAIWLFALQVHPEHVPSFQNLRDVTCREGLVSFADL
SAHAIRVIHTNLQADAPYCRGFDIATWLKTDQAAVVDQQDKPKRTAQVASRINSYSKVLQ
VVTTLTVDAEGITNSTSKGFSFSPSHDIFAEHCAAIAAYLDEQQISTQSDISTQVHKLMT
RTLSQAVEDRIVSSAFIELWLHNLQFYNQATPPRTIIIVYSRKGAFSKVLLECLFTAVYS
QNPVQVLDEDSFQVQQQSADLPAKRAPDVFVFSILDGGRSCTSHWAPPCQQAAADVVERY
GNSSTVLVMIAGEPWDVQRLDERVLLISTVSQVPKDKYVYLPMASMFFGERVIQSPMLLL
ASHRARKSSIQSIDTSLLPRKFCAYMYARCDRPQREYMFDLLNALEPIDALGVCQGAAQK
QIQQRWRSRWSVSVFQDAINMYAQYKFVIAFENAQQPGYVTEKIMNAFLAGSIPIYLGHS
DSVSRLFNSRSFIDCGKFATLRKCAERVMEIHQSTELYESMLSEPVIGNVTLFYELFSWH
PDVPSSHLASQVARLI

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	256	458	8.2e-39	0.984375
GT10	787	951	1.7e-35	0.4438040345821326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.15e-29	255	460	1	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	8.34e-15	814	938	17	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
178735	PLN03193	3.27e-11	241	459	140	348	beta-1,3-galactosyltransferase; Provisional
215596	PLN03133	1.30e-10	239	449	384	579	beta-1,3-galactosyltransferase; Provisional
140237	PTZ00210	5.95e-04	331	383	189	240	UDP-GlcNAc-dependent glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPW18992.1|GT10	2.48e-20	786	945	111	267
UNG09896.1|GT10	3.22e-20	768	945	84	258
QED36502.1|GT10	1.25e-19	792	949	109	264
AEJ34901.1|GT10	5.04e-19	781	949	50	215
SDS24656.1|GT10	9.46e-19	768	945	87	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	7.02e-14	794	959	174	328	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	5.42e-13	794	959	174	328	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]
6WMN_A	2.73e-10	230	480	99	339	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_C Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_D Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_A Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
7JHK_A	2.83e-10	230	480	105	345	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHN_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
7JHI_A	3.05e-10	230	480	119	359	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JI67|B3GT5_MOUSE	2.39e-18	234	471	49	275	Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
sp|Q9N295|B3GT5_PANTR	2.69e-18	234	471	51	277	Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan troglodytes OX=9598 GN=B3GALT5 PE=3 SV=1
sp|Q5UQ63|YR654_MIMIV	3.50e-18	781	949	405	570	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q9N294|B3GT5_PANPA	3.88e-18	234	471	51	277	Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan paniscus OX=9597 GN=B3GALT5 PE=3 SV=1
sp|Q9N293|B3GT5_GORGO	2.22e-17	234	471	51	277	Beta-1,3-galactosyltransferase 5 (Fragment) OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT5 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001335	0.998613	CS pos: 24-25. Pr: 0.9611

TMHMM  Annotations     

There is no transmembrane helices in PIW_T001050-RA-p1.