CAZyme Information: PIW_T000523-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T000523-RA-p1
• CAZy Family: AA17
• CAZyme Description: Glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	PiwaDAOMBR242034_SC00029|CGC1	43368.63	5.0491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00029:33887-35307(+)

Full Sequence      

MLTRVVLSAATVASALLLATTSALDQSLYGINYDLRQGPDWDPSKCKSAATIAADLKVLK
TITTNVRTYSLSDCDVAPLLTAAKSLGLTVWLGVWVSADTSVYDSEVAALKKLIQAKLID
SNVVGFNVGSEAVYRKDITAEKSIEYLKDFKSVLTKNSITAPVSITDIVDILTQYPDMIA
AGDVVTTNQFPFWEKMEPSKAVAQFKTRIQPLINLAAGKELIISETGWSTGGKSANASAA
TPEGAARYLNDFYLLAKAEGWKYYYFSGFDTPYKAEQMQEPDTVEVYFGLFGTDGKMKSA
YSDLKIAKIATTESTSGSTTGTSGTDSSSPSAGTGTDSTTGKATSGGTTDSTSTSPGSVH
AGASSSVGTGAVSKSNSSSSSSAKNGTSANTTSASSPLATAGLTACAAIISAVFMSL

Enzyme Prediction     

No EC number prediction in PIW_T000523-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	45	298	5.7e-21	0.9453376205787781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.01e-36	8	294	10	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.14e-11	30	298	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	3.40e-89	17	304	11	298
AIG56195.1|GH17	4.15e-81	14	306	3	312
AIG56392.1|GH17	2.95e-76	13	308	9	310
AIG55438.1|GH17	3.22e-76	16	298	11	303
UIZ28880.1|GH17	4.54e-70	30	298	18	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.77e-36	26	298	35	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.01e-35	26	298	35	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43070|BGL2_CANAX	1.99e-22	42	298	31	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	2.96e-22	46	298	40	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	3.34e-21	42	298	31	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|D4B2W4|BGL2_ARTBC	6.24e-21	45	308	36	305	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|A2QN74|BTGC_ASPNC	4.22e-19	24	298	383	670	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999724	CS pos: 23-24. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in PIW_T000523-RA-p1.