CAZyme Information: PIW_T000111-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T000111-RA-p1
• CAZy Family: AA16
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		85134.97	6.7076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00004:58676-61088(+)

Full Sequence      

MAWDKKLRWTCAMLALVLCVALPVVRAVSAADDAIEAMLSSMSVDDMLGQMTQLDISTVM
NADMTLNRDKVRAHAKLKIGSYLNSPSATTILTYSTNARVFSATEWRAVISQIQEIFLEV
PGNHPILYGIDSVHGAVHVKGALIFGQQINSAATFNPDIVFKMGRITSRDTLAAGIPWIF
SPILEISQNPLWARTFETFGEDPHLVSVMADAIVRGLQDSNSSAACMKHFIGYSKTPTGH
DREGVTLSDFDLLNYFALPFLAAIKAGALTTMESYISINGDPVVANSKVLQDLLRHDMGF
DGMVVTDWAEINNLHDYHRVAATEEIAVEMALSRTPLDLSMVPLNTKFIESAKRALQRQP
RLLERIKASARRILKLKKRLGLYQNPLPGADNVSKVGQHEDKQLALQLGRESIILLKNQD
NVLPLRKSSSTFLTGQAADNVGFLCGGWTLIWQGVSGNDLLPNGISLKQGIEGVIDDKSR
IRYFNPLEANGDVRAQDLETAKTMAKAAEYTIITVGEAPYAEKPGDIEDLALSPGQVEYV
RQIAATGTKIILVLVQGRPRLLNGIGDLAHAVIYAMLPGEIGGQAIAEVIYGDVNPSGRL
PITYPKHPGSIAIPYNHRVTTVCGDKPCEMEWEFGHGLSYTTFAYSNLKLSKSTLSNHGC
ERLGIDVTVTNSGQREGKETVMLFLIQPFRTISVPEVKQLKKFEKILLKPGESRVVSFEL
TREDWGVFDPQIGNGFNKIVENGVYFIAIKPETECSVYKEGSVAPKSLCGKFSIVE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	322	1.1e-58	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.07e-110	7	733	1	751	beta-glucosidase BglX.
224389	BglX	1.68e-68	42	450	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.79e-53	139	718	108	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.58e-48	109	376	51	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.40e-45	413	640	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27116.1|GH3	0.0	51	774	1	724
UIZ29009.1|GH3	6.42e-303	30	774	25	762
CCA27737.1|GH3	3.59e-291	4	774	33	808
UIZ29432.1|GH3	2.53e-268	25	774	16	763
UIZ29613.1|GH3	1.22e-267	25	774	61	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.83e-132	23	724	5	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5Z87_A	5.27e-83	94	754	93	775	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5Z9S_A	6.24e-81	31	749	24	771	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
6R5I_A	2.55e-80	107	732	59	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.31e-79	107	732	59	705	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.07e-146	29	749	74	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.86e-131	23	724	27	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	9.55e-83	107	723	90	728	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.84e-82	125	723	105	728	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	5.51e-79	112	766	49	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000709	0.999250	CS pos: 27-28. Pr: 0.9821

TMHMM  Annotations     

Start	End
7	29