CAZyme Information: PIW_T000030-RA-p1

Basic Information

• Species: Globisporangium iwayamae
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium iwayamae
• CAZyme ID: PIW_T000030-RA-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		72888.15	7.6529

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GiwayamaeDAOMBR242034	14874	1223558	0	14874

• Gene Location: location=PiwaDAOMBR242034_SC00002:13329-15260(-)

Full Sequence      

MPEQTSSSSAGPAKKGSFLPIVLSAKSNRKKTMPAYAKRRSRSDSNDQLMANSAPALPVK
KRRTASGSLSDRRTWNVLWALFIVAFLICMVCLVMLGSMVQQNQLSNGDVDGSSQKAGFF
GGVGANWRGEQMFEKLKKLTTGVFSATSADNTVNTPRARRELLDLGEYECRAWRQTMNCT
PEGLPESTNDQNCSSPIPNGVSGYCEVQHKTTGEIKKVMGMHCDSLRPGVTFSCDMFQTL
LSYHILSTDYVHDTKFSFEANQQVFRDKNGIAATPAPIDEDGFKNESVGQQELSFERGLV
YVIYEKLLLGAFVSVKSLRALGCTLPIEMWYKRDETNVNHPLLKYMVAEYGVYLREIDDP
NATHFYTKLHALFYSAFDNVLLLDADNFAVRDPTYLFDTKEFVSTGAMFWPDFWKPANTI
FNIHENSFVWEFFGLDYVDMFEQESGQLLINRRKHLTALNVVMYYGFKLPRLHEDLRLVW
GDKDLFRFGWMKSNSEFYMIPRPPGSAGTKHADYDLFCGVTMVQHDPSGRVIFLHRNTEK
LTHLNDRLLWTHIQQYKRTSKLDEYFVRGANGGKVFPQFKRCFGKDVHYEKLFTLKPMSA
FPFETLETALLQYSSDGAAIMNIPTLFGGKGVEPSTLVVDAET

Enzyme Prediction     

No EC number prediction in PIW_T000030-RA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	297	526	2.6e-50	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.99e-38	297	526	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.33e-06	305	422	10	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24059.1|GT71	7.72e-256	14	625	4	603
UIZ24000.1|GT71	1.35e-200	52	621	5	571
CCA25989.1|GT71	4.58e-153	164	612	92	534
CCA20051.1|GT71	2.83e-120	151	626	63	543
AIG56191.1|GT71	2.96e-106	167	620	42	489

PDB Hits     

PIW_T000030-RA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.72e-17	296	527	245	527	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	5.75e-16	298	526	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.22e-14	244	526	89	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	1.61e-14	244	526	89	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	4.54e-11	298	500	294	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
75	97