CAZyme Information: PITG_22227-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_22227-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: pectate lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		25181.65	9.9277

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=GG689347:383-1081(+)

Full Sequence      

EPYTVKKGRTFDGGMKTYARSNVKCGGQKKSGWQSAVFMVEPGATLKNVIIGKDQMEGVH
CEQNGCTIQNVWWEDVCEDALSIKGGSASSVTKVIGGGARSADDKVIQHNGLGTVSIEGF
YAQDFGKLYRSCGTCGDKSRKVSLTNVLAVNGKVSLVTVNKNWGDQATLQNIKIKARRWT
CASGRRAPLWASPRSWAPVRRGRSASTPPAPSPTHKLEGLQYPMLQDSCLDW

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	2	182	1.7e-80	0.9278350515463918

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	2.14e-93	1	173	15	182	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18840.1|PL3_2	1.06e-118	1	178	47	224
ADN18837.1|PL3_2	2.71e-107	1	178	47	224
ADN18841.1|PL3_2	3.97e-86	5	176	41	212
ADN18836.1|PL3_2	9.74e-81	2	171	34	203
ADN18839.1|PL3_2	3.14e-75	1	183	39	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	6.77e-27	1	133	7	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	4.32e-23	5	173	16	181	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	4.42e-23	5	173	17	182	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	8.54e-23	17	175	8	181	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z03_A	3.99e-22	5	173	25	190	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA88|PLYD_EMENI	1.14e-62	3	171	55	220	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	2.73e-62	1	171	38	203	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	4.38e-60	10	169	54	210	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	7.42e-60	8	171	57	216	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|A1C4B8|PLYE_ASPCL	2.49e-59	10	169	54	210	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_22227-t26_1-p1.