CAZyme Information: PITG_22085-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_22085-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		48013.88	4.1793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS029253:62-1390(+)

Full Sequence      

MTDESVVLPEFGVQSNTYAACLDGAKRDRYIWLGDFYHTTRIMGVANSKPEQITGTWKYL
FDYQASNGQFPGLMTMTYETPMPTPEVFMFNAGTSDAYLNFPDYDILGLIGFVSYMEYYD
DVEFAKANWESLQKATAWLVSCRDSNGLIDVTKYVAVFLGSGTGTAVNAAAVQCLNGMAK
VAKSIGDEASANQWVEVASSIKTAMNDLLWDDTLGNYAVDASTPQVYGVSAIAFAITSGV
ANETQTDICVKSLENLRRGPGYIDTSVTDNSSKISPNTNGFLLDALLQTGHTNEAAFLLD
NLWDAMISNEYYRSGASWEYVSQSLEPGLKEFTSLSHPWGGAPTYVLTNYVAGIRPLVFG
FRHWIVNPMVTGLNITSANATVSTPYGALTAGWEKTDSNILSSTIAAPLGTEGVFEVVLL
NSSTFQQKLAGTGEPIVFSVQL

Enzyme Prediction     

No EC number prediction in PITG_22085-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	12	414	1.9e-61	0.7380952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	8.93e-12	62	351	74	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.77e-07	353	419	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
237326	treA	0.004	118	218	285	392	alpha,alpha-trehalase TreA.
273702	oligosac_amyl	0.005	120	211	370	459	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	8.99e-98	1	426	387	826
ATZ56607.1|GH78	4.00e-97	1	426	411	850
UDD59244.1|GH78	1.66e-91	7	415	136	551
QMW40986.1|GH78	4.95e-89	7	415	391	806
QMW28911.1|GH78	4.95e-89	7	415	391	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	2.72e-08	23	350	237	541	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

PITG_22085-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_22085-t26_1-p1.