CAZyme Information: PITG_21462-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_21462-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: pectin lyase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		42381.05	6.2214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028435:790-2131(-)

Full Sequence      

MARFQFTLAAMLALAANRASAFTIGSPSGLAAGTTGGAGGETVYPTSPSELVAYLNDTEP
LVIVLNQTIDFRGTEGTTTEMGCRPGHKRACLAKNNGFNDQDVILGPGGLNNTGGCTNGT
EIEVTYDNAAIKRMSVKGNKTIRGIGKSGVIMGKGLTLNGDNIIVQNIHITELNPHATTT
LNKIWIDHVKVSHVGRQMVVTNKAGVATLTISNSDFDGNTEYSATCDGHHYWTFLFYGKN
TGVSMLNNYVHGTSGRSPKVGGNPNEHVVVHVANNQWGNNSGHSFELGVNAYVLAEGNYF
DNTKQPLDKGEDGLLYAVDDADVCSKYLGRQCAANVLVGSGNFTSRNGPAALEGSSDSEQ
EQTQQYTPGTAAPSGEVTQSSIHLAKVWAETTDNFGVGKLN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	302	3.1e-72	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.73e-26	124	304	2	190	Amb_all domain.
226384	PelB	1.59e-10	124	401	85	345	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.93e-07	127	300	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	7.95e-215	1	401	1	441
ADN18835.1|PL1_4	3.23e-214	1	401	1	441
AHX74068.1|PL1_4	1.43e-162	4	401	4	400
ADN18834.1|PL1_4	3.84e-160	4	401	4	400
ACR19258.1|PL1_4	4.72e-152	1	317	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.06e-69	24	344	4	323	Pectin Lyase B [Aspergillus niger]
1IDK_A	3.62e-67	25	344	5	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	6.14e-65	25	344	5	322	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	2.88e-81	7	400	9	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	2.88e-81	7	400	9	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q5BA61|PELB_EMENI	5.51e-81	3	343	2	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q0CZD4|PELF2_ASPTN	6.65e-80	24	345	24	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B0XT36|PELA_ASPFC	6.66e-79	8	344	6	341	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999772	CS pos: 21-22. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in PITG_21462-t26_1-p1.