CAZyme Information: PITG_21328-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_21328-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	DS028398|CGC1	26193.18	9.3280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028398:3273-4300(+)

Full Sequence      

MKQLLAVYHSLWKISMPLVSWYVRRKDLQRLVPRAVTDERFGHSEPPDNCITVWIHGASV
GECLSALPLVKLALSDKLDQALASSTGREKNKVRVVLSTTTTAAHQVVTHRLKDHENAVC
VLAPLDHQQCVQRFYDAWQPDVGIWIESEIWPTLITEAARRGIRIGLLNGRMSSQSFRFW
RLPGLNESSKSIVGLFSLVLCQDEQNRKRFEHLGAQNAHSALNLKFGTTSCL

Enzyme Prediction     

No EC number prediction in PITG_21328-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	38	226	5.5e-45	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398219	Glycos_transf_N	8.22e-58	38	226	1	174	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
235589	PRK05749	8.76e-43	4	226	2	210	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.60e-41	4	229	1	211	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG51867.1|GT30	2.88e-34	8	226	7	209
BBK39579.1|GT30	3.05e-33	7	225	5	207
URK19762.1|GT30	8.00e-33	8	226	7	209
CCQ74891.1|GT30	1.53e-32	4	228	2	210
BBK45120.1|GT30	8.50e-32	7	225	5	207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	3.31e-06	39	226	28	184	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	7.69e-22	7	215	10	204	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q1RGU8|KDTA_RICBR	2.07e-20	23	226	26	206	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q4UND5|KDTA_RICFE	4.90e-20	53	226	98	253	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	3.13e-19	53	232	93	254	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
sp|Q68XV7|KDTA_RICTY	6.93e-18	53	232	95	256	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_21328-t26_1-p1.