CAZyme Information: PITG_21308-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_21308-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: choline dehydrogenase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		53321.37	8.2055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028596:42062-43793(-)

Full Sequence      

MIRHVLRLPCRRGVSTLRTVQEFDYVIVGGGSAGCVLANRLSADASNSVLLQHLNGRCLT
WPRGRVLGGSSSINAMLYSRGHSLDYDDWQQAGADGWSYADCLPYFKKAQTHSLGADEYR
GGDGTLHVTTTRPAAVPNDVNGHQQEGVGWLDHTIHNGQRCSASAAYLTDSVLARENLIV
ATDTFVNKVLFEGKKAVILSSGAINSPQLLMLSGVGDAEHLRKIGVPVAHHLPAVGQNME
EHLGVYLHVACKKPVTLYHATPHFPRKMAWMGIQWLVSKTRMGTSSHIEAGGFFRSASGK
RHPDLKWQFLPGASDEDRQLLRDGHAMMLHCTALRATSRGYIKLRSANPRDSPVIQPNYL
ATESDRVDMRNGVRLTREVLMQQALDEYRGEAISPIAGVQSDAEIDAWIRQNASTDYHPS
STNRMVHGLEGLRVVDASIMPNNVSGNLNAPTIMLAEKAADIILGNPAPPKSNALVYEST
NWETSQR

Enzyme Prediction     

No EC number prediction in PITG_21308-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	467	6.3e-85	0.5097087378640777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	19	487	2	555	choline dehydrogenase; Validated
225186	BetA	1.51e-128	22	469	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.38e-44	23	243	1	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	7.42e-35	337	459	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.93e-15	23	455	56	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	2.20e-201	1	487	1	581
CAB3230510.1|AA3_2	1.50e-149	6	486	7	578
AWP09430.1|AA3_2	3.01e-145	13	480	11	567
ANI26486.1|AA3_2	3.74e-142	22	486	70	624
AFP03409.1|AA3_2	6.99e-121	96	486	2	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	1.54e-60	21	465	6	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.54e-60	21	465	6	562	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.54e-60	21	465	6	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.08e-60	21	465	22	578	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	2.98e-60	21	465	6	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	3.08e-156	9	486	30	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	3.52e-153	7	486	28	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.21e-152	21	486	39	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8D3K2|BETA_VIBVU	1.82e-129	21	487	3	554	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	2.32e-129	23	487	5	554	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PITG_21308-t26_1-p1.