CAZyme Information: PITG_21028-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_21028-t26_1-p1
• CAZy Family: PL3|PL3
• CAZyme Description: mannosyl-oligosaccharide glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	DS028399|CGC1	33329.67	5.9130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028399:89828-90750(+)

Full Sequence      

MEEDGYIAREQILGQDARRRVPREFLVQHVEHANPPTLLLALEKMMQWHKAADSDEDLKA
FVRTVFPFLKRWYSWFLKTQYGPHDASFRWRGRLPNDGKLISNTLSSGLDDYPRASRPSE
NEMHVDLLSWMIRSSNVMAKLADFIDRDADVQLFESNSAHFLSGLDEHHWNEEAQSYFDV
GEHSEDGVIEYQVAVRCRNEQGQVVDTTAPIAQIETKQVKCPDSHPNFMFPLGDGRGGLQ
MLPVFVPRTTKLQHVKHVGYVSVFPLLLKADDGPSAALVAVWTALSVDARSVL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	8.34e-74	1	278	123	368	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28949.1|GH63	1.05e-166	1	280	483	762
AIG56123.1|GH63	1.05e-73	1	269	409	660
CCA18876.1|GH63	9.14e-73	1	269	535	824
AIG55648.1|GH63	1.16e-68	1	269	407	660
AGD95913.1|GH63	2.45e-49	1	278	48	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	4.14e-40	1	278	420	651	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	4.09e-23	2	189	424	650	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80UM7|MOGS_MOUSE	1.05e-40	1	278	475	706	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	4.94e-40	1	278	478	709	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	1.24e-39	1	278	475	706	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q19426|MOGS1_CAEEL	3.09e-35	1	186	427	612	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2
sp|O14255|GCS1_SCHPO	1.66e-31	1	179	439	649	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_21028-t26_1-p1.