CAZyme Information: PITG_18452-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_18452-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: thioredoxin reductase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856		93703.21	5.3564

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028179:394837-398045(-)

Full Sequence      

MASGVNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED
RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKP
QGVMPSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSK
EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW
NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH
PRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALE
CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ
LLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPN
IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEED
SIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAG
EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGVYFRTSIFISTNMRLSG
SFPCSTFLLLLALLPACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQG
INTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS
GYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYS
WQVYKNCVGLSKNPTA

Enzyme Prediction     

No EC number prediction in PITG_18452-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	713	853	1.9e-41	0.5469387755102041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273624	TGR	0.0	162	648	1	479	thioredoxin and glutathione reductase selenoprotein. This homodimeric, FAD-containing member of the pyridine nucleotide disulfide oxidoreductase family contains a C-terminal motif Cys-SeCys-Gly, where SeCys is selenocysteine encoded by TGA (in some sequence reports interpreted as a stop codon). In some members of this subfamily, Cys-SeCys-Gly is replaced by Cys-Cys-Gly. The reach of the selenium atom at the C-term arm of the protein is proposed to allow broad substrate specificity.
185416	PTZ00052	0.0	159	646	1	487	thioredoxin reductase; Provisional
235701	PRK06116	3.34e-149	161	636	2	449	glutathione reductase; Validated
224169	Lpd	5.27e-111	161	636	2	453	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component or related enzyme [Energy production and conversion].
215301	PLN02546	3.89e-101	125	636	33	531	glutathione reductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY67612.1|AA17	0.0	1	856	1	856
UIZ26027.1|AA17	0.0	1	856	1	841
ETI35285.1|AA17	6.59e-129	656	856	1	201
EGZ27343.1|AA17	2.58e-87	711	856	1	146
ETI48337.1|AA17	4.06e-48	692	851	12	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H6V_A	3.14e-172	161	643	10	489	Mammalian thioredoxin reductase [Rattus norvegicus],1H6V_B Mammalian thioredoxin reductase [Rattus norvegicus],1H6V_C Mammalian thioredoxin reductase [Rattus norvegicus],1H6V_D Mammalian thioredoxin reductase [Rattus norvegicus],1H6V_E Mammalian thioredoxin reductase [Rattus norvegicus],1H6V_F Mammalian thioredoxin reductase [Rattus norvegicus]
3EAN_A	6.26e-172	161	643	10	489	Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAN_B Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAN_C Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAN_D Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAN_E Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAN_F Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with reduced C-terminal tail [Rattus norvegicus],3EAO_A Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],3EAO_B Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],3EAO_C Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],3EAO_D Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],3EAO_E Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],3EAO_F Crystal structure of recombinant rat selenoprotein thioredoxin reductase 1 with oxidized C-terminal tail [Rattus norvegicus],4KPR_A Tetrameric form of rat selenoprotein thioredoxin reductase 1 [Rattus norvegicus],4KPR_B Tetrameric form of rat selenoprotein thioredoxin reductase 1 [Rattus norvegicus],4KPR_E Tetrameric form of rat selenoprotein thioredoxin reductase 1 [Rattus norvegicus],4KPR_F Tetrameric form of rat selenoprotein thioredoxin reductase 1 [Rattus norvegicus]
2ZZ0_A	2.26e-170	161	643	24	503	Crystal structure of human thioredoxin reductase I (SeCys 498 Cys) [Homo sapiens],2ZZ0_B Crystal structure of human thioredoxin reductase I (SeCys 498 Cys) [Homo sapiens],2ZZ0_C Crystal structure of human thioredoxin reductase I (SeCys 498 Cys) [Homo sapiens],2ZZ0_D Crystal structure of human thioredoxin reductase I (SeCys 498 Cys) [Homo sapiens],2ZZB_A Crystal structure of human thioredoxin reductase I and terpyridine platinum(II) [Homo sapiens],2ZZB_B Crystal structure of human thioredoxin reductase I and terpyridine platinum(II) [Homo sapiens],2ZZB_C Crystal structure of human thioredoxin reductase I and terpyridine platinum(II) [Homo sapiens],2ZZB_D Crystal structure of human thioredoxin reductase I and terpyridine platinum(II) [Homo sapiens],2ZZC_A Crystal structure of NADP(H):human thioredoxin reductase I [Homo sapiens],2ZZC_B Crystal structure of NADP(H):human thioredoxin reductase I [Homo sapiens],2ZZC_C Crystal structure of NADP(H):human thioredoxin reductase I [Homo sapiens],2ZZC_D Crystal structure of NADP(H):human thioredoxin reductase I [Homo sapiens]
2J3N_A	2.77e-170	161	643	30	509	X-ray structure of human thioredoxin reductase 1 [Homo sapiens],2J3N_B X-ray structure of human thioredoxin reductase 1 [Homo sapiens],2J3N_C X-ray structure of human thioredoxin reductase 1 [Homo sapiens],2J3N_D X-ray structure of human thioredoxin reductase 1 [Homo sapiens],2J3N_E X-ray structure of human thioredoxin reductase 1 [Homo sapiens],2J3N_F X-ray structure of human thioredoxin reductase 1 [Homo sapiens]
3QFA_A	2.77e-170	161	643	30	509	Crystal structure of the human thioredoxin reductase-thioredoxin complex [Homo sapiens],3QFA_B Crystal structure of the human thioredoxin reductase-thioredoxin complex [Homo sapiens],3QFB_A Crystal structure of the human thioredoxin reductase-thioredoxin complex [Homo sapiens],3QFB_B Crystal structure of the human thioredoxin reductase-thioredoxin complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O89049|TRXR1_RAT	3.22e-171	161	643	10	489	Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Txnrd1 PE=1 SV=5
sp|O62768|TRXR1_BOVIN	1.28e-170	162	643	11	489	Thioredoxin reductase 1, cytoplasmic OS=Bos taurus OX=9913 GN=TXNRD1 PE=2 SV=3
sp|Q5NVA2|TRXR1_PONAB	5.11e-170	161	643	10	489	Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii OX=9601 GN=TXNRD1 PE=2 SV=3
sp|Q9JMH6|TRXR1_MOUSE	1.62e-168	161	643	124	603	Thioredoxin reductase 1, cytoplasmic OS=Mus musculus OX=10090 GN=Txnrd1 PE=1 SV=3
sp|Q9MYY8|TRXR1_PIG	3.23e-168	162	643	11	489	Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa OX=9823 GN=TXNRD1 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_18452-t26_1-p1.