CAZyme Information: PITG_18335-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_18335-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	DS028184|CGC3	46583.64	4.2503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028184:368887-370218(-)

Full Sequence      

MRTILHSRLAVTAVSCMALTLSSIGLSSAEELCSIPPYSYTGAKQSHPELTTAIETLENY
AIASWFTDRQSTDERSTTISDMLSQCSEDTRLSVVVYGIPNKDCAAGLSSEGSVKSTDDY
KAFLQELTDAVGDRKVLYVVEPDALGLLTQNGGCGASAGYLDNLKVAVAALSANANAELY
VDIGYWMLADSASKVATAMKDIGSSGRVKGVTINTSNYRSNDECAGYCTNFQTAMGSTDM
KCIVDTSRNYNGSPTSDWCNVPTAGIGKPPTSETGISNIDYFMWIKPPGESDGECPTGGT
SAGSFYLEGFTLLWDQGYFVSEQGMSKIGDGSGTPAGTAYPTSLSTGSSSQSSTDQTPPS
PTPTTDNSSWNQEQTAGTVAPADTTPATQETATPSMAPVPESTALSTSIPVTMTPSTTEP
VTEVLVVPSQIACKAKKRLRSRN

Enzyme Prediction     

No EC number prediction in PITG_18335-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	43	296	1.3e-62	0.9421768707482994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	3.05e-53	48	301	2	293	Glycosyl hydrolases family 6.
227616	CelA1	4.20e-17	86	306	180	399	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
236776	PRK10856	0.002	366	430	148	214	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	1.85e-189	5	383	2	375
UIZ23641.1|GH6	1.35e-92	26	328	22	332
AIG55493.1|GH6	1.66e-82	17	333	7	313
AIG55974.1|GH6	1.11e-81	29	328	22	324
AIG55492.1|GH6	3.39e-81	17	333	5	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	2.34e-28	94	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	2.34e-28	94	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	3.53e-28	94	305	94	301	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	6.11e-28	94	305	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	1.36e-27	94	293	70	266	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	1.48e-29	94	299	104	307	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	7.49e-26	94	293	101	297	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|Q7SIG5|GUN6_HUMIN	6.92e-25	88	316	77	340	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|Q5B2E8|CBHC_EMENI	3.82e-23	29	320	110	445	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|P13933|GUN1_STRSS	4.65e-23	55	306	105	354	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000521	0.999449	CS pos: 29-30. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in PITG_18335-t26_1-p1.