CAZyme Information: PITG_18279-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_18279-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1157		128801.97	5.1051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028183:671396-675164(-)

Full Sequence      

MVLGCYAIAVLSSYLVGLAPKASTLQNGVQEQQRVLHHQKVVEVGPIKVETTANDPEEGW
PVQEPGGAEAAVQGDMSRDLELEQEHEAAGEMGAREDEHVDAASENAGTGIERTLEAPAI
TATSIPPATLSPSTVETHSAPEKNVDIPTRRNDVVLLTANQEEAENKETTDTNAMSDSNG
VSLKDPNDAEADLQAPQEKWEVEGSTTSDAIEPPGPLATPTSDETQPPVRHSDQFYKALD
LVFPYETKPPNPYFHVFPVSKNSPGDDAALVSGLRNNAADRDSWSVEGYQHELDRLEGIK
REANEETERLKRLVGATDKLISEEKDRLEDKRAASTLDIRRHQPKRIRSKLKCMGWRQTG
QCNPYGKREPNSDLACNQIAQGGVSGYCEVLDEETGELFRVMQLNCSSVRDHVVFSCAEA
ADFANFGLLAQGVYESALAQNKSDPLKLLGNNGKGNGIVMVVYPKLLSSVFASISVLRSY
NCTLPIELWISQPEVVRTPSMRTTLEMLQQRFFLVTVETIIDPTIAGFSTKIHAVQHSKF
EYVLFLDADNVPVRDPTFLFETKEFREHGAIFWPDFWHPEKTIFNIQRESLLWELVDLPF
VDMFEQESGQILIDRRRAAVAMEVLMFFAYHRPSHFERLVLAHGDKDLFRLAWMKTHTPF
YMMPFPPASAGTERGTYKKQFCDVAVGDGEEVMFPANRTAVQRMMSYQDIKQKYQIGIQP
SGVLFKEFETCYGAEPNAVSNYNLTKFEDLPFANLEQQLIDYAHEGALLMVQAQGPVRGA
TRNEHLGNDMILRRWLVPLLALLLPTSMGQQCAYFSQDDLLSRLEYRVPRCLGPSASSSV
LSTLTERFVANEFDRHQPLALVLFSNSSDLLHSLAGSVASSLFGASRSPHTVQNVDFQVL
LEPSRTSNYDIKQKLRSALATPLGACPDRSLFVLDNVQALDDAALPALDVFLDPLNGKRA
QFQHYVDGKASRVFDCTNSIFLFLYKIAANQSPLDGGESGSGSSSKWREFLMQHWTRSEG
TLEEFTPQAFVGRLTDAIAVFPPDGDDSTESSYDEFKQSREWRQMCELQSENEPGKAGDN
TEIFAASALSRVAGNVAAATPVISGAIAMISIPAYLLILTRAKRWNEETTKQRGHIHRRR
NSGSSGSTRRKRRKTRK

Enzyme Prediction     

No EC number prediction in PITG_18279-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	455	687	1.6e-50	0.9848484848484849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.07e-32	455	687	1	270	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	2.86e-06	477	585	23	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132997	Glyco_tranf_GTA_type	0.006	458	574	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24000.1|GT71	1.18e-85	349	789	102	590
UIZ24059.1|GT71	1.53e-79	349	787	711	1200
CCA25989.1|GT71	1.31e-75	349	765	94	538
CCA25306.1|GT71	9.22e-75	335	774	48	540
UIZ27901.1|GT71	1.67e-74	351	671	70	386

PDB Hits     

PITG_18279-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD72|MNN24_CANAL	2.01e-13	454	790	291	652	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|P38069|MNN2_YEAST	2.87e-10	454	649	169	402	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	1.65e-09	426	680	247	527	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|Q5AP90|MNN23_CANAL	3.09e-08	526	663	250	424	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|A6ZQE9|MNN5_YEAS7	3.97e-08	457	663	151	408	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.856811	0.143193

TMHMM  Annotations     

Start	End
1097	1119