CAZyme Information: PITG_18271-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_18271-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564	DS028183|CGC1	64267.76	7.7307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028183:642699-644393(-)

Full Sequence      

MLPALPVFSRPQHDTKLPIKGYSSPIRVLFERVVRCGQRWPRALLFISALIYVSALITWA
SNNSDKHDATPVKILPSGEVVPRRLRCVAWRATAKCRPNGPREPQNDKKCSDFVVGDVSG
FCEVEDIDTGERFQVMRRHCNSLKGNIKFRCSDARTFVNYRVDGHGAVAKALVPGFSLPH
VAENSEAPRDGIVMVVYPKLLASAYATVRVLREVVMCRLPIEIWFHVDEIGADYALLVPL
QQLAIFVGNVSFHPMYNPRAKGFLSKVFAIYNTYFDRVLFLDADNVPVRDPSFLFSTPEF
KANGAVFWPDFWHPHRTLFNLHAQSMLWELLDTPFIDMFEQESGQLLVDRTRHAAPLELV
YFYAFHEPNFFEKLDVVYGDKDLFRLAWMKLKVPFHMVEALPAMAGRAINGSFCGMTMAQ
HDTKGEVLFLHRNQHKLTGERDEKMEKAASENTVVPPDEALGAPHPDGYPDPVIWTHLLS
FRKDANRKLYTIDAYRASPEFPQWQPCYGRRYEEQQKVFELHEFANLSFAGIETDIRHFA
LDAARLRHAQNVAWVGASPSNSTA

Enzyme Prediction     

No EC number prediction in PITG_18271-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	190	422	1.9e-47	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.31e-36	190	422	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	6.15e-08	251	337	66	156	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	4.66e-129	194	556	1	367
UIZ27901.1|GT71	3.20e-99	47	444	27	426
UIZ24000.1|GT71	5.83e-97	85	543	104	567
UIZ24059.1|GT71	9.22e-95	87	544	143	596
CCA25989.1|GT71	1.01e-92	87	536	98	532

PDB Hits     

PITG_18271-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46982|MNN5_YEAST	1.52e-13	176	461	137	464	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	2.38e-13	190	398	293	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|P38069|MNN2_YEAST	8.33e-13	261	422	245	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	1.43e-12	176	443	137	454	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	5.56e-11	191	422	175	449	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999921	0.000097

TMHMM  Annotations     

There is no transmembrane helices in PITG_18271-t26_1-p1.