CAZyme Information: PITG_18262-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_18262-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	DS028183|CGC1	43889.35	7.5015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028183:520617-521756(+)

Full Sequence      

MICMYDGVLNMGLSLIRELRCLGNQELIQIYHCGGDELSGRSVNLLFSLDDRVELVDVCS
DFSSRGVISSNMTTNFQSWWIKPLAMYHTDIRHVMLLDVDDVIMKDPAVLRDLDGYMKTG
TTFFYDRVAHKKRFLNGNDHGRYYLRRLLREFDYARFNVSRGFAPSQHVLNSFAYKGKSC
HEMDSSMVLIDKERAGNTVMKIMFWFITEERFRFKYSWGDKETFWLAFELAHVTYTYSPW
GVSVVNSMPNEDMKRHPDALCGSILQFVPIDNSEIEVLYVNGKALIDPYPQGVAYIRKAK
QNNLFNMLPTHMTPRQYRREVNTTAHQKEKFNIECLPGMGSTLLPASFSHNLLRRRLHFL
GVATDVIGSLQHCETYDQA

Enzyme Prediction     

No EC number prediction in PITG_18262-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	4	262	8.3e-41	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.21e-18	11	235	15	240	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22801.1|GT71	1.40e-119	2	373	63	430
CCA15193.1|GT71	9.16e-116	2	374	136	516
BAP68847.1|GT71	1.89e-90	3	284	71	358
AIG56397.1|GT71	9.95e-63	3	367	97	462
AIG56246.1|GT71	1.76e-57	4	341	71	432

PDB Hits     

PITG_18262-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AGA0|MNN1_CANAL	5.55e-10	68	310	452	692	Putative alpha-1,3-mannosyltransferase MNN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN1 PE=2 SV=1
sp|Q5AGA9|MNN13_CANAL	1.64e-08	76	230	431	578	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2
sp|P53059|MNT2_YEAST	3.18e-07	6	282	183	460	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|P53745|MNT4_YEAST	5.71e-07	13	282	213	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_18262-t26_1-p1.