CAZyme Information: PITG_17947-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_17947-t26_1-p1
• CAZy Family: GT57
• CAZyme Description: chitinase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	DS028181|CGC3	25734.33	4.0824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028181:560013-560717(+)

Full Sequence      

MKFVGVIASSLLVVPSAVSGDADSSSFALFFDQDRFQEVFPDAVELYNFNGLVDAASKYS
EFANTGNDDNDKRELAAFLAQTAHECDSFKAAEEYARDTYSVWQYCDNTTYTCAPGRRYH
GRGPIQLSWNYNYYNAGEALGIDLLNNPDIVATDTTVTWMTALWYWMTPHGGRVIHDIVA
GENGFAQSTDIINGGLECGPDAPNTSNEQQRITYFTKMCEALGVEPLGATSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	31	232	3e-64	0.961038961038961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	1.03e-73	31	232	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.69e-53	47	232	25	232	Chitinase class I.
225720	COG3179	1.63e-11	33	196	6	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	0.003	111	168	19	75	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	1.85e-175	1	234	1	234
CCD28125.1|GH19	1.25e-136	14	234	40	260
UIZ22871.1|GH19	6.40e-131	14	234	35	256
AIG55513.1|CBM1|GH19	8.74e-61	30	233	24	223
AVH63884.1|CBM50|GH19	8.97e-60	27	232	77	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH1_A	6.56e-55	36	226	13	200	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	3.61e-54	36	226	12	199	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
2CJL_A	6.42e-52	35	232	7	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1WVU_A	6.01e-47	20	232	53	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
7F88_A	9.76e-47	36	226	19	191	Chain A, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P86473|CHIT_ACTCC	5.58e-48	47	224	100	299	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|Q41596|CHI1_THECC	3.03e-47	47	224	99	298	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P05315|CHIT_SOLTU	3.97e-46	47	226	106	307	Endochitinase OS=Solanum tuberosum OX=4113 PE=2 SV=1
sp|P52405|CHI3_SOLTU	4.37e-46	47	233	96	304	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
sp|P52404|CHI2_SOLTU	1.16e-45	47	233	94	302	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000322	0.999663	CS pos: 20-21. Pr: 0.8550

TMHMM  Annotations     

There is no transmembrane helices in PITG_17947-t26_1-p1.