CAZyme Information: PITG_16965-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_16965-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: glucan 1,3-beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		46353.73	6.1072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028164:238368-239612(+)

Full Sequence      

MQTNLAIFTVLAGLHVAALCSADASPSSNSTLEASTGFTHVRAGIRDGSIRSRGVNLGGW
LVAEHWMTADAAFWQGVKDHFANSGEYTSISKASSPDNIRTKLGEHHAAFITEDDIAQIA
TAGLNTVRVPLGFWILGYDNFDPSSQHEWQVYTRGTIAYLDQLIRYWAKKHNVAVLLSLH
AAKGSQNGADHSSPASPGHPLWSQYSENVANTIEVARFLADRYRGDEAFLGIGLLNEPNG
STDEKVLYQYYKDAYQAVRSTGSDCVLSIMPMLQKQSPDEMVGFMEAPEFTNVWVEWHPY
FIWGYEHTPDDQLVNVAVKQEYRGRVDKWNARPGHNRLFIGEWSVATASNMRRTNADLFY
TFAMEQLKVHEAAEGGWTLWSWKASAGSNRDVEDWSLQKLLADDRLGRILRNYQ

Enzyme Prediction     

No EC number prediction in PITG_16965-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	104	385	2.5e-47	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.30e-26	53	394	19	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.17e-12	110	384	24	270	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29004.1|GH5	1.05e-229	8	411	7	407
UIZ29069.1|GH5	9.04e-156	19	410	23	413
AAM18484.1|GH5	6.13e-110	41	403	9	365
UIZ29723.1|GH5	1.01e-109	41	403	1	357
CCA17636.1|GH5	1.21e-108	38	414	124	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.09e-29	53	400	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.39e-29	53	400	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.51e-29	53	400	16	378	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	2.05e-29	53	400	15	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PC8_A	2.08e-29	53	400	16	378	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.81e-37	53	400	38	397	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|O93983|EXG2_WICAO	2.31e-34	53	400	43	407	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	2.63e-34	53	394	43	394	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	6.73e-33	53	394	43	395	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q12700|EXG_SCHOC	1.47e-32	54	401	44	405	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000379	0.999608	CS pos: 22-23. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in PITG_16965-t26_1-p1.