CAZyme Information: PITG_16135-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_16135-t26_1-p1
• CAZy Family: GT19
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		35269.00	4.3634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028158:1168002-1168991(-)

Full Sequence      

MVFSSTTCILGVAALASAYLAAPAAAADEPLPWDGRVFDLTVDTLPDKYLTHILTMRNNG
TDGKVSDYVSIEKDGRSPGYNGDTGVINIGVDAKAIFKTQNNFRRSELVQNIAANTKGTT
FFRTSVMKEEAFLNPYAWQMIFPESHIFEIRVDASASPAKIIYLNNGTWDAKWETEFVPG
TWYNFGIGISAATSGNGSVLEFYTSEGDKELALEATHDVVTEFPSTYEFHYGLLTLSDDG
SEPKMNAKQDIVSYNGVSVEADVSTSATGDAASKASKTTGSIGAESSSYVSTETTEAPTT
QNETPATQNEIPATKTGIVKSSDGGCARK

Enzyme Prediction     

No EC number prediction in PITG_16135-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	62	269	6.6e-24	0.8549019607843137

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	4.59e-73	33	265	3	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26396.1|GH131	1.30e-105	1	271	1	270
CCD28226.1|GH131	1.02e-100	14	267	5	256
UIZ26845.1|GH131	4.69e-98	9	267	343	602
CCA28146.1|GH0	8.13e-22	26	266	17	254
CCA67649.1|CBM1|GH131	3.02e-11	33	242	23	226

PDB Hits     

PITG_16135-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PITG_16135-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999668	CS pos: 27-28. Pr: 0.7726

TMHMM  Annotations     

There is no transmembrane helices in PITG_16135-t26_1-p1.