CAZyme Information: PITG_15905-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_15905-t26_1-p1
• CAZy Family: GT10
• CAZyme Description: beta glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
743	DS028156|CGC1	81010.42	4.5274

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028156:823684-826000(-)

Full Sequence      

MLKSWFAAVCCLAVSLTGTPFVSADEWDAQTDVIIESMDEDQLVGQMVQVAFSRFFNKDK
TFDEDKFRAYAKLKIGSYLSGPWQSGSYNGKYGWTAQEWRDVLSRAQEIVKEENDGHPFI
FGIDSLHGAGFTSGAVLFGQPINGAATFNPDLAYEMGRISGRDTLAAGTPWIFGPMLEIS
QNPLWPRVYETFGEDPVLVSAISEALIKGIQSNNGSAACMKHWIGYSKTPTGHDKDPVTL
SDLDLLNYFLPPFKAAVDAGVMSAMENYISVNGIPTIANHKLMNKLLREDLGFEGLTVVR
PLASSDYGFINATKALIANEPSYLNRVKESARRVIKLKLQLGLYDNAVPGADLVDQVGND
EDKAATLNSARESIVLLQNNDSVLPIPETAKVLLTGHSADNVGFQCGGWSLSQQGYSGND
MFPNGITVKDEFQAISNETLTYFNGLNYTGVYNESDLAQAKEYASQADYTVAVIGEHSYT
EKTYGDINDLALPAGQIEYVSELASTGTKVIVVLVGGRPRLLGELPNNVHAVINAMLPCE
LGGQAIAEIIYGRVNPSGRMPITYPKDAGNILMPYNHLVSTQCATGYCEMQWEFGHGLSY
TDFTYSDMTLSRSNVTSITESVDVSVVVTSAGTVAGKETVMLFLTQPFRTISVPEVKQLK
KFTKVDLKAGESTTVKFTLSADDWSVYYPQIGSGLKKVAEDADYVLAIKPETDCDVYNKT
AVANPLCATFTLQTGEHPYGSFE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	298	1.8e-54	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.60e-89	118	700	105	742	beta-glucosidase BglX.
224389	BglX	1.78e-58	41	419	4	381	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.48e-48	118	679	83	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	6.20e-48	374	600	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.77e-44	41	312	3	260	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	5.52e-288	1	732	1	762
UIZ29613.1|GH3	1.92e-260	1	738	46	825
UIZ29432.1|GH3	3.98e-256	1	738	1	769
UIZ27116.1|GH3	1.15e-254	47	733	1	725
CCA27737.1|GH3	3.66e-254	12	732	41	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.99e-101	72	683	65	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXN_A	9.45e-73	23	708	6	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5XXL_A	1.80e-72	23	708	6	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	6.83e-71	101	686	79	726	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	9.43e-71	101	686	79	726	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	7.82e-116	28	708	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.81e-102	1	683	8	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	2.43e-64	100	682	87	728	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	4.59e-64	100	682	87	728	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	4.25e-63	102	715	50	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999757	CS pos: 24-25. Pr: 0.9752

TMHMM  Annotations     

There is no transmembrane helices in PITG_15905-t26_1-p1.