CAZyme Information: PITG_15882-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_15882-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1004		113852.75	5.1873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028156:699106-702181(-)

Full Sequence      

MSDDVSNLEDILVDEEYLNNANNSELARDRPLRPAPPSSLSPHESRRASIDAYDAREDHF
GRDNEENEEDDGQDVPQDSEDVREDSVPCEEDDEDAPPQLRSRNRLGEARTPSELHAASR
SPPRSMSLGGFTVDDEDVMEMNAREQELLVNIQELQRQLSMVQIQTDKPQEEIVPPMMDA
RHRLIMVSNRLPISFQRNENTGEWSFTMSSGGLVTALNGIRDQVPFIWIGWLGEEIPHDE
QSKVREKLAREFNCVPVFLSKEIAARYYNDFSNDILWPIFHYVPLPLFRPGSEKKFDFRQ
WDAYKLANKRFAQAVNQVYREGDFVWVHDYHLMMLPSLLRARHPQCKVGWFLHTPFPTAE
MYRMLPVGREILEGLLGADLLGFHTYDYARHFIAACARVPGASTSPKGVELGDHFSAIGV
FPIGIDPEHFEDILNSEATQKRIQELTMKFAGCKIIIGVDRMDYIKGIPHKLLAMERFLS
LYPERCKDVVLIQIGVPSRTGVQEYQHLAASVNEMVGRINGRFGTLTHSPVHYIHRSVTP
SELVALYNLADVCLVTSIRDGMNLVSHEYVMCQSQSCEPHREGPGVLILSEFAGSAQSLS
GAIRVNPWNTTDMANALSYALELPLMEREYRQRNLYRYVKTHTASFWGKSFLTDLEDAVS
RPRAVVKKLVRLPTIEVLGAYTRSCHRLLVLDYEGTLFDDLTAGPSQQRGSVAPPKPFVK
RLIDALANDPKNTVVLVSSHERNVIGSWLTDRRVGVVAESGYFYRLPNEDEWQVMTEDTD
PSWKKVVRPIMQYFTERTPGSRIESKESSLAWHYGETDPIFGPMQARDMQVNLEDVLCNL
PLEVVQGTNRVEVRLQGVTKTLLLDEIFKQFQLDSVPSSPSCRREGLSPRQSRRRRPPSP
QLDFVFYAGNGVEDDELFLYFKEHTELARKEEETCQPGTAPTNAGSDVLPPLSLPDASNL
PADSVSALSKRADVFTCHIGGTKTEAMFHLERPSDLARMLRSMT

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	178	656	1.5e-194	0.9789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	183	657	2	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	0.0	178	661	11	483	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	0.0	106	1003	12	844	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
215556	PLN03064	0.0	90	1004	2	927	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	183	656	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA16456.1|GT20	0.0	103	1003	92	966
UIZ21560.1|GT20	0.0	5	658	1	655
CCA20339.1|GT20	0.0	135	1003	35	927
AJA04606.1|GT20	1.48e-241	98	924	22	837
AGT80036.1|GT20	1.48e-241	98	924	22	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	1.35e-174	183	655	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	7.56e-174	183	655	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	7.58e-173	183	655	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.07e-172	183	655	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	6.67e-169	182	655	11	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.58e-224	183	873	17	684	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	1.09e-193	181	867	91	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	7.90e-185	181	930	11	730	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|P40387|TPS1_SCHPO	6.95e-182	183	656	20	482	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q00764|TPS1_YEAST	2.60e-179	184	660	18	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_15882-t26_1-p1.