CAZyme Information: PITG_15478-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_15478-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		25989.65	4.5432

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028154:1155261-1156256(+)

Full Sequence      

MRVRACTLYDKSGAELISKLTTKSTRDSKQTMLKKWLLPVCIAAVGLVATSADDLDARAN
SIVENFTENQVVGQLAQIAVFALLNEDYSLNEDLVRYYAKRHVGSFLTTPFTNGPNELTF
AVGWNVAEWRNIITRIQEIVMEENDGIPMIFGIDSVHGAGFVLNTTLFGAQINGAATFNP
DLVYEMGRVTGQDTQAAGIPWIFGPILEISSNPLWARTYETFGEDPHLVSLLTLAL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	143	234	5e-26	0.4212962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395747	Glyco_hydro_3	2.00e-23	72	235	6	155	Glycosyl hydrolase family 3 N terminal domain.
224389	BglX	4.07e-22	123	235	37	151	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.95e-16	35	232	2	184	beta-glucosidase BglX.
178629	PLN03080	1.58e-04	154	230	89	181	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	4.72e-64	32	232	1	202
UIZ29613.1|GH3	1.31e-55	2	236	20	249
AIG55676.1|GH3	8.32e-53	40	230	24	213
CCA27737.1|GH3	1.39e-52	35	232	37	239
UIZ27116.1|GH3	2.28e-49	75	236	1	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.48e-23	64	225	22	180	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5Z9S_A	2.79e-20	58	236	27	178	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
1LQ2_A	4.68e-20	123	233	64	174	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	4.70e-20	123	233	64	174	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JG6_A	4.71e-20	123	233	68	178	Crystal structure of barley exohydrolaseI W286A mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.30e-34	56	232	77	254	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.28e-22	64	225	44	202	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	2.00e-11	35	232	2	184	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	8.97e-11	130	232	86	184	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|B8NGU6|BGLC_ASPFN	1.46e-07	55	232	49	226	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.727211	0.272777

TMHMM  Annotations     

There is no transmembrane helices in PITG_15478-t26_1-p1.