CAZyme Information: PITG_15381-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_15381-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44177.22	8.6365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028154:350730-351946(-)

Full Sequence      

MAKSGFESTMGITETNRSVNLDPSVQHIPLNPSLSHLRPPPARVSDNPKLFVGLSVFRDG
YRCATTILTGFKRATNPANIVFGVVDQVYPSDQKCLDEFCKMATQTWPDQGQCPYKAQIR
VDERSAYESRGPTLARHQQQNLIKDEEFCLQLDGHSIFTNGWDENLLKEWKGIDNEMAVL
TTYIHHIHNFVAANGDNVPPKKLDLPHLCTTMRGSNGLVRTVGASMIGGSKMPQLQALWG
AGFSYNKCHAEKRVRVDSHTLWMFDGEEFLRASRLWTHGYDMYSPSRLGTVVYHNYTSVP
ARFEGIPVDQKLKDKEEEMGVNRFKVLVGQPFEGRVSTMELQKYGFGNVRSFKQYLEFSA
TLGAIHQLDRSRGDCRRRLETRRLLNAIW

Enzyme Prediction     

No EC number prediction in PITG_15381-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	50	358	1.5e-59	0.9757575757575757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	9.72e-43	50	358	2	344	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVE55543.1|GT60	4.46e-232	1	359	20	375
UIZ25301.1|GT60	2.82e-219	1	358	1	358
UIZ22573.1|GT60	1.16e-168	6	359	28	379
UIZ25379.1|GT60	6.26e-134	8	359	30	381
UIZ22347.1|GT60	3.89e-38	33	359	42	358

PDB Hits     

PITG_15381-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	8.10e-16	50	294	6	247	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999845	0.000164

TMHMM  Annotations     

There is no transmembrane helices in PITG_15381-t26_1-p1.