CAZyme Information: PITG_14173-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_14173-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		92139.74	5.3973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028149:1055845-1058467(+)

Full Sequence      

MALNESSPLLQGRAAQQQSGRPPLRRALYVIVPLALVAIVTICILVGSNGSKKASAASNS
APAATNAPAEVELTDSELLTMRPPFEEKLHPLPPKLVRRNDFGRSLPTNEFWSSLMVADS
HGLNAGAGEVTLSPYTVRSLPKRLDISYGDSRRVATKDAITEYFNVDASFTAYSHKVLHG
NETGSALLGDGNSTSRNIVGFDVLSVLLQYYYGEDNKWMKVPMVRGSPYITVEYQNVLPV
LEFNATVFTINGEQVEQKDPLAPWNELQTWTSSRFELDIEVYGTGESAHGTGKSQQKWVL
YFDKVRTLQLQYANETDYRPYNWRGELTTPTNIRLVDTDFYTGAARLAVVPQGASHAAIE
ALDKAAAIYPVGSSISTDVKDSDASFSFCWKTKRFPDLGEPNLNSTSTAELLMMANPHHV
ATFKTDSNVFQVLGQFGHRTLKSNMTAVLGSCWEMHETLPTASFHEQDVPIQPQYLEAIK
VALANDSNYTPEADDPYYFGKEIGRQARLVLIADKLDAKELRDDMLDKLEEWLTPWMLGQ
NSDHFVYDRSWGGLCSLNGLKGVFWMTDFGNGWYNDHHFHYGYFLYAVGVVGKFRPDFVK
THKAVVMSIVRDIASPDQSDTFFPFTRHFSWFDSHSFASGVYTLDGGKSQESVSEAINAY
YGVYLVGKSFSVPEVEHMGHLLLALEIRGAQTYWQMPSSSDIYEPIYAANKMTGQVAATK
VSYTTWFGPQVEHMHLINMIPFTPITDAFLKPAYVQEEYPILQQQAFGRAQDPIEDRWKG
YAYLDLAIIDPADAWTKVQNMTFFDDGSSRTNSLYWIATRPTN

Enzyme Prediction     

No EC number prediction in PITG_14173-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	90	816	1.9e-151	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.66e-94	476	814	7	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.36e-86	67	814	50	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.63e-25	90	461	1	312	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24045.1|GH81	0.0	1	620	1	611
CCA19047.1|GH81	4.71e-272	5	820	9	815
UIZ24044.1|GH81	2.88e-134	621	823	5	207
AGP40408.1|GH81	1.07e-112	75	821	50	702
AUX36386.1|GH81	4.14e-111	75	821	61	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.05e-65	85	821	21	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.51e-65	85	821	46	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.78e-64	85	821	21	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.35e-38	480	817	326	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.42e-23	431	817	297	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	2.02e-53	70	818	44	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	5.82e-51	81	811	12	693	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.22e-47	409	810	475	892	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.23e-44	206	818	557	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.19e-43	322	814	267	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000025

TMHMM  Annotations     

Start	End
27	49