CAZyme Information: PITG_13721-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13721-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1207		133151.35	6.0290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028147:393089-396826(+)

Full Sequence      

MGEEVAALHVAAASPPASGVLSPRNDFFVSQRAATDFELSRLDTLSLEEQEILANIQELQ
LQLMQLRAEQEEDSDDDSTDKPLNSSGNQLIVVSNNLPVLLERQPQTGRWKATKTTGGLD
KLMCLTGVRAEMNFLWVGWVGQHIPKSEHEAVRRLLLQHNCLPVFLSSDVASRHTGFSSE
VLWSLFHYVSEPVPFTFNTGNSSSFHPTKRFNKQDWRAYESANESFADAIAEMYNEGDSV
WVHDYHLMLLPSLLRQRIPLCRIGWFLHTPFPASDVYCRLPVRSQLLTGVLQADLVGFQT
FDYERHFLSTCHRLLGVECSHKGVRSVSPDRDHFTSIGVFPIGISLEPFARAASSMPTLN
RVNELHDKFGGKRIILGIDRLDNIKGIPHKMLAMEMLLDRFPEWQHNVVLVQIGISSRSG
VVDSKSTGANDNTRRASASSASGDSSALLPRSASYPIVGPTSSTGSDSPIKSLSESPPKA
ASPMAGGKGNIGYDPCHQLEMSSHSYHNIVTQVNQIVGRINGIFGTLDYAPIHFIQQQAT
PHEELCALYDLADVCLVTSTRDGMNLVSHEFIVCQQHFMRNKDERKKAARAATRKLSSSL
TKSGVLSPIQSPRQSSASVLTDWEGEDGGPGVLVVSEFAGCSQSLSGAIVVNPWNIEDVA
LSVHQALSMCRTEREIRQQKLYRYVSSNTASAWGEQFLEELNEAVEKNRKSSTQLPKLDR
KTIVRAYRSAQNRVIILDYDRTLTPQHSLLPLAAVGPNFKALLDALSTDERNTVFIVSGR
ERKFLETWLNGVRVGVAAEDGFFYRMNLSNTREHWKTMSKFQYDVATARSGGSTATMAGV
GSVIGSLDASYSSEAHSMMHMSMGSLPAYSRHSSVPGSTNTGDNTPVAGSIAPTDDSFGG
DDMSWKDLVLPTMLTFTDRTPGSYIEDKESSLTWHYGDADPHFGSWQAKDLQIILERQLI
GTALEVYQGHMSVSVEHEGCTKTRNDQAVDFVLCVCDDVTDDQMFQTLNALVAESNERHD
ERKRKEEEEAENERIRRNSIALSSSASSQLRAQAVPSAAHVSKAKPRMPRPRGNGVTDEL
DPTVKLKAVRRRHHNEQIIGAAAAAVRGHDEYSTDDDDELDAGDVMDDDNKVAFSRLQKV
PVRLAENVEIFAVVVGPDVQHSGGRHACSFAVDSLADVRKVLKEFVDESRERGTADGGDD
IASLSPP

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	86	424	1.4e-107	0.671578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	90	1008	3	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.16e-175	89	702	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215556	PLN03064	2.44e-169	89	995	95	796	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	9.14e-168	90	703	3	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	2.41e-161	89	995	12	706	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29831.1|GT20	0.0	1	1193	1	1210
CCA23376.1|GT20	0.0	18	1189	475	1629
CCA20339.1|GT20	6.77e-182	16	1005	15	795
CCA16456.1|GT20	7.56e-179	45	1005	127	878
AJA04606.1|GT20	8.54e-164	84	1017	124	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.93e-112	84	702	6	475	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	3.29e-111	89	702	1	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	5.10e-111	88	701	11	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.57e-110	89	701	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	9.64e-110	89	701	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.17e-151	89	956	17	644	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	6.66e-128	89	982	93	767	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	5.01e-123	89	982	13	681	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|Q0WUI9|TPS8_ARATH	6.09e-123	77	1012	43	794	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q00764|TPS1_YEAST	8.93e-123	84	701	12	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_13721-t26_1-p1.