CAZyme Information: PITG_13569-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13569-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		89189.87	6.5788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028146:1056211-1059195(+)

Full Sequence      

MTLLDVGSLKAIVRVRSDSHTFVKRGKKLPRRFFKTFFGGQDQLRNCDPTFNCLDTFDVQ
HPRIWTESDAASTSGSGDSPMASSNGSSATQNTGGGDFLAPFSTEEPSTTLFPRSALGEM
APIINVAEGLLGKPLPTNKWWGNIIHTTAEEMDTKANPGWSNPYAVKLPKEAPYGIQACY
SYNYRQLSALTDGVAEFYLHDFVNDLTLSATEFAGEAKPTYEIYAFSDFGINVRACLENK
VQCLDSALVHGMAFITATYDRLTARIESEYTMEIVDKSVPGKYILQLGGNQTWVVYTGNN
GSFALAESGKALVSSGLFSGTVRVAILPSKKATTVYDKYRACHVRGGNVSVESRTQYSLN
WETVGKSCKTNGMLHFALPHHLPALKGAITAKSPKAIVLNSATRGKMVAQVATTGKWVLS
EPEDELEVDFYPTSKPSAEVVAKVGLLQTLQADIADHWALNKTSWYFNGKQYQKYASVCL
MAADSAIVGKDKKLLSACLTKLEKLLVPFLDNTLDPPLHYETSYGGLVSSQSFTVQDVNA
DFGNSVYNDHHYHYGYWVTASAMLKSLHPKWERIKELDRMIWMMLRDVANPSTDDPFFPQ
FRHFSFYLGHSYSHGVTPMLDGKDEESTSEDVNFYYGMKLWGQVSSNKAVEDLGSLMLRL
NARAIRTYFLMTSDNTIHPTEFVPNHVTGIFFDNKAAYATWFSGEKYAIHGIQMIPVSPI
NAMVRTTKFVQQEWDDILSKQPIVTESNTTNAWLSLLLVNQAAVDQEDALTKLQEATMDD
GLTRSWALYNAASRPHNAKQVDVA

Enzyme Prediction     

No EC number prediction in PITG_13569-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	128	789	1.1e-169	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.54e-139	434	788	3	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.26e-132	59	792	21	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.91e-45	132	432	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
226277	RgpF	0.003	554	715	63	208	Lipopolysaccharide biosynthesis protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	95	794	41	740
UIZ26440.1|GH81	0.0	95	794	41	740
UIZ26131.1|GH81	5.14e-291	98	794	12	714
UIZ26137.1|GH81	3.96e-288	98	794	122	824
UIZ26602.1|GH81	3.96e-288	98	794	122	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.90e-94	95	796	5	720	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.69e-93	89	796	23	745	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.33e-89	95	796	5	720	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.67e-26	109	738	11	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.64e-22	431	780	354	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.33e-94	97	792	2	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.52e-85	110	792	54	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	6.65e-85	134	792	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.07e-82	134	788	110	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	8.64e-79	96	792	426	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PITG_13569-t26_1-p1.