CAZyme Information: PITG_13566-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13566-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	DS028146|CGC4	55831.05	7.0733

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028146:1035922-1038379(+)

Full Sequence      

MAPIINVAEGLLGKPLPTNKWWGNIIHTTAEEMNTKANPGWSNPYAVKLPKEAPYGIQAC
YSYNYRQLSAITDGVAELYLHDFVNDLTLSATEFAGEAKPTYEIYAFSDFGINVRACLEN
KEQCLDSALVHGMAFITATYDRLTARIESEYTMEIVDKSVPGKYILQLGGNQTWVVYTGN
NGSFALDESGKALVSSGLFSGTVRVAILPSKKATTVYDKYRACHVRGGHVSVESRTQYPV
NWETVGKSCKTNGMLHFALPHHLPALKGAITAKSPKAIVLNSATRGKMVAQVATTGKWVL
SEPEDELEVDFYPTSKPSAEVVAKVGLLQTLQADIADHWALNKTSWYFNGKQYQKYASQG
QEAAQRMPDEAREAPCAVPGHTLDPPLHYETSYGDLHTTFRYMSKFGCLGHLSTGSALFG
VWCPIQPADEIMWGQLDGYHIALPHQSRQQESCTSKLSISTTATLTTSHYTPALDNPTTR
QSSTPLTFHQSATLLAARQSSSPPTARQT

Enzyme Prediction     

No EC number prediction in PITG_13566-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	10	365	2.1e-52	0.5048231511254019

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	1.52e-45	13	313	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	3.80e-23	15	404	89	497	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	4.29e-148	1	399	66	476
UIZ26440.1|GH81	4.29e-148	1	399	66	476
UIZ26131.1|GH81	1.34e-125	1	393	35	444
UIZ26137.1|GH81	1.26e-119	1	393	145	554
UIZ26602.1|GH81	1.26e-119	1	393	145	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.09e-19	13	357	38	396	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.14e-19	13	357	63	421	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.51e-17	13	357	38	396	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AIR7|ENG1_CANAL	4.42e-14	13	399	458	874	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000014

TMHMM  Annotations     

There is no transmembrane helices in PITG_13566-t26_1-p1.