CAZyme Information: PITG_13560-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13560-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		22465.28	4.4282

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028146:967164-967863(-)

Full Sequence      

MKLPLVIAATAATVAAFPAFAKDEFCGQYDSIQAGDYIVHNNLWGQDNDKAGGQCTGLDS
IDGSTIAWHMSFPSWVGDNWQVKSYANAALKFNLVQLSSVKSIPTTMEYTYKYDGNIITN
VAYDLFTSPSIGGETAYELMVWLAALGGAWPLTTTGQPIKSVKLGGVDFNLYQGWNNKTK
VFTYQFFDELPADNTIETTQARTPL

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	95	185	2.3e-23	0.5897435897435898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	4.36e-23	35	184	1	147	Glycosyl hydrolase family 12.
235746	PRK06215	3.50e-10	26	184	41	179	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABG91065.1|GH12	1.86e-103	1	200	1	213
AAT66504.1|GH12	4.49e-99	1	200	1	210
EGZ11358.1|GH12	4.49e-99	1	200	1	210
ABB22033.1|GH12	1.03e-95	1	200	1	211
ABB22025.1|GH12	1.72e-87	1	200	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	1.71e-50	24	184	26	184	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	9.15e-50	22	197	11	177	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	2.11e-49	24	197	6	170	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
6K9D_A	1.20e-32	26	191	4	163	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	1.74e-32	26	191	5	164	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	5.28e-61	1	184	4	180	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	1.75e-56	24	184	20	179	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|A1XP58|XGEA_ASPNG	3.22e-52	22	184	21	182	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|Q4WJU8|XGEA_ASPFU	8.36e-52	1	184	1	179	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|B0XNQ1|XGEA_ASPFC	8.36e-52	1	184	1	179	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999716	CS pos: 21-22. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in PITG_13560-t26_1-p1.