CAZyme Information: PITG_13523-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13523-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467		51804.37	4.7398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028146:719639-721237(+)

Full Sequence      

MKTEAAIAGLLSLAGVAGITSAEPSWHNLAITVPRYGRYLTRTVSEEPFFWQADTAWKLV
HRLNKTSIGFYLKTRAEQGYNVVQTVLVSELNGTTRSNFYGDLPFSNSDPTQPNDAYFEL
VDWTVDLAASYGILMALVPTWGMYVNGGWHSTTPIFNESNAYDWGKYIGERYPGLPKLLG
GDSNVMWSWNISEVQAAYAEDPDQDLPSLLAPIEDTSAVWASMNRGLKEAERAQGYESVV
IYHPAAGWIVKPEVTPEAYGHNVLPNEQDRMSIDAVQSGHATPDPTSKFTPTIGWDSTKN
YDLIANMRDRSTGPVIDLENHYEGAHDSFNLERQIWNSSQIRTGLYHGVYGGACGFTYGA
NSVWQIPSSHTGKSVNTYEGTRYISVLATKNRDRYYVYTGHGDSFALQLDNGSGARFGTA
RWFSPRDGQYYADAAISVLERGNATHIDFTPPSGGSIDDDWLLVLEF

Enzyme Prediction     

No EC number prediction in PITG_13523-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	31	372	1.2e-63	0.6966019417475728

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.43e-103	37	365	2	279	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.14e-13	376	466	10	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	8.15e-145	20	466	23	534
KAF3763706.1|GH140	8.70e-133	20	465	21	535
KNX49908.1|GH140	1.47e-73	28	462	13	514
KAE8156220.1|GH140	1.29e-60	19	466	14	508
KAB8203844.1|GH140	2.52e-60	19	466	14	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.49e-22	26	465	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	7.02e-21	26	465	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PITG_13523-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000477	0.999513	CS pos: 22-23. Pr: 0.9707

TMHMM  Annotations     

There is no transmembrane helices in PITG_13523-t26_1-p1.