CAZyme Information: PITG_13291-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13291-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296		32483.81	9.1061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028145:980684-981574(-)

Full Sequence      

MVLAVFAFAFGSILWNHEDPVAGIKQIVSRLFPVQRGLCHAYWAPNFWALYAFLDKVLVT
LGFPASTEGIALMSGGLVQEASFAVLPTVSPLACAVLTFAMMTPVLRSIWKYPDSSLFTS
ALAYCMLCSFLLGYHVHEKAILQVTLPLALMAADSVASMRLYRFASGVATISLFPLLFTP
AEQGSKVLVGACHALLVEVVLVPLLKHSLKERHIKVTAVGMSIFERVFLTGLAGLALLAV
MFPYIPRIGAQYPFLPLMFISVGCAIGNIYVWGFTVTQHFRKLDAVKYYLDAQRPK

Enzyme Prediction     

EC	2.4.1.265:13	2.4.1.-:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	1	273	3.7e-63	0.5467775467775468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	1.67e-72	2	272	215	472	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29794.1|GT57	3.21e-184	1	296	279	574
CCA20034.1|GT57	2.05e-75	1	271	236	495
VDD04801.1|GT57	2.26e-50	1	272	222	498
CAG7873952.1|GT57	8.03e-50	1	272	222	494
VDC69742.1|GT57	8.03e-50	1	272	222	494

PDB Hits     

PITG_13291-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O80505|ALG8_ARATH	4.57e-47	1	272	225	497	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=At2g44660 PE=2 SV=3
sp|Q6P8H8|ALG8_MOUSE	1.78e-40	1	272	244	507	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg8 PE=2 SV=2
sp|Q7RXP5|ALG8_NEUCR	2.57e-40	2	276	232	500	Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-8 PE=3 SV=2
sp|Q9BVK2|ALG8_HUMAN	4.67e-39	1	272	244	507	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG8 PE=1 SV=2
sp|Q0P5D9|ALG8_BOVIN	4.57e-38	1	272	244	507	Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Bos taurus OX=9913 GN=ALG8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996089	0.003900

TMHMM  Annotations     

Start	End
83	102
117	136
161	183
187	209
222	244
254	276