CAZyme Information: PITG_13172-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_13172-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: GPI mannosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	DS028142|CGC1	48514.96	9.0893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028142:1986159-1987523(+)

Full Sequence      

MQSRIVVFAAATRACVTLLALSTSAIVVPYDTSSHLQAGGSPFAPLSNWDGVYYSHIALH
GYDFEHFHAFFPLYPLLARLLAGLMPLETSSAVMVSGWLVSNASFVLAALFLYRLGCVVL
RDELVARRAAYLFCVAPSSIFMSAIYSESLMCLLSFSGMYFLAKHAQQPKTSQSFLDLVL
CALLFGAASATRSNGVLLSLFIAWYRVTVSPSPREFFRFLGFWIRTAVLGILAIGPQIVY
FVTSMVPYCPSLVQRFGWEVFGTGEREDRSWCENAVPNLTAMYSFIQSKYWNVGLFRYYE
WKQLPNFILAAPIFLLSFHALDGYFRRSVVPGQSIVVSEPQGRGWRGTALTPYYVHWLFL
VVNALLVVHIQVTTRFLCACPPLFWHPAMLMCGSKVKSKAPPVLTSYGRLVVSYFLLFTV
LGSVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in PITG_13172-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	6	433	2.1e-106	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.56e-50	5	433	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.65e-15	25	321	49	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	2.23e-236	2	433	6	439
CCA18790.1|GT76	1.16e-117	8	433	12	490
ACO67127.1|GT76	7.18e-60	13	433	13	421
BBN03197.1|GT76	1.45e-53	49	433	84	482
BAT74870.1|GT76	3.74e-51	26	433	47	493

PDB Hits     

PITG_13172-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TPN3|PIGV_MOUSE	2.68e-36	46	433	63	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q9NUD9|PIGV_HUMAN	5.08e-36	46	433	63	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q290J8|PIGV_DROPS	9.06e-34	46	433	63	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	2.89e-33	46	433	63	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.56e-31	39	431	71	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000918	0.999070	CS pos: 25-26. Pr: 0.9731

TMHMM  Annotations     

Start	End
5	27
94	116
129	151
179	201
221	243
304	321
353	375
410	432