CAZyme Information: PITG_12832-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_12832-t26_1-p1
• CAZy Family: GH53
• CAZyme Description: cutinase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		22083.57	8.7324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028144:1721404-1722057(+)

Full Sequence      

MKFSSSCSVVFSALMLLLTGPVNVAAQCSDVHIVFARGSGEMPGFGICGTPLVSGIKSNL
AGLSVSSYAVNYLASVAQTSAGPGATDMTNQVKAVAQQCPNTVFVLGGYSQGASVTDIAI
GIKTMLGVGASIPEELAPRIKAIVTFGNPLKLMGQTIARSSQLYGSKAIEFCNLGDPVCA
NGFNTMAHITYPMDGSVTKAAAQAAALVKGNARALRG

Enzyme Prediction     

No EC number prediction in PITG_12832-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	205	3.9e-52	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	8.99e-41	27	196	1	162	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAX55266.1|CE5	2.82e-148	1	217	1	217
EEY60079.1|CE5	1.13e-110	1	216	1	214
AAO92431.1|CE5	8.23e-108	1	217	1	223
AAO92430.1|CE5	8.23e-108	1	217	1	223
AAY43367.1|CE5	1.46e-106	1	210	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.51e-16	28	200	79	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
4OYY_A	1.47e-12	25	194	14	179	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1BS9_A	2.48e-12	27	191	1	190	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	2.48e-12	27	191	1	190	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1G66_A	3.43e-12	28	191	2	190	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	1.51e-57	25	209	33	219	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P0A537|CULP3_MYCBO	5.39e-38	21	214	37	228	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	5.39e-38	21	214	37	228	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P9WP38|CULP3_MYCTO	1.66e-36	22	182	38	198	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|O06319|CULP4_MYCTU	1.40e-32	2	191	19	210	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999763	CS pos: 26-27. Pr: 0.9667

TMHMM  Annotations     

There is no transmembrane helices in PITG_12832-t26_1-p1.