CAZyme Information: PITG_12344-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_12344-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: endoglucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	DS028143|CGC1	33321.47	4.6239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028143:186963-187968(-)

Full Sequence      

MLGNILGSRLVTAAVSCAALALSSASAEELCSVVAYSFTVAKSTYPDLSTALGTLENNAI
ASWFTDRSTTEERAGLLSRMLSQCPESSRLSIVVYGIPQKDCAGGFSTGGSVTDTNSYKT
FLKQLTDTIGDRKVLYVVEPDAVGLLTQDNGCGAAAGYLENLKVAVAALSVNPNAELYLD
VGYWMLAYPNSAAKVANAMTDIGNSGRVKGITINTSNYRSNDECAGYCTNFQNAMGSTAM
TCIVDTSRNYNGSPTNDWCNIPTAGIGKPPTSNTGYSNLDYFMWIKPPGESDGNCWGGPA
AGSWGCQRLARLLALL

Enzyme Prediction     

No EC number prediction in PITG_12344-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	43	295	1.3e-59	0.9319727891156463

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.92e-47	61	300	17	292	Glycosyl hydrolases family 6.
227616	CelA1	2.76e-14	75	299	170	392	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	1.04e-150	6	303	2	298
CCA16954.1|GH6	8.38e-78	28	295	21	287
AIG55974.1|GH6	2.75e-77	18	304	13	301
UIZ23641.1|GH6	3.81e-75	11	302	9	307
AIG55493.1|GH6	7.32e-69	37	312	29	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	1.16e-29	62	293	40	266	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
1UP0_A	1.93e-28	52	307	32	283	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	1.93e-28	52	307	32	283	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
2BOE_X	2.28e-28	62	293	40	266	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
1UOZ_A	2.87e-28	52	307	53	304	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	4.21e-28	63	293	75	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	6.81e-28	62	293	71	297	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	9.46e-27	92	304	238	435	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|Q7SIG5|GUN6_HUMIN	6.72e-26	86	304	77	330	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P13933|GUN1_STRSS	1.05e-24	61	293	113	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.037262	0.962702	CS pos: 27-28. Pr: 0.7343

TMHMM  Annotations     

There is no transmembrane helices in PITG_12344-t26_1-p1.