CAZyme Information: PITG_11993-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_11993-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538		57714.96	4.3157

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028138:1539603-1541219(-)

Full Sequence      

MKLARLLGLVAASFSTCSAGSSFIDFRSVDGKLKADNETFHLKGINWFGAETIELAVQGL
WPSATSIGDAMDLFASYDINALRLPLAMDSVMDDPKVKSTQTGGSPSLAGKTYLEVLDVI
VREARARNILIMFDSHRIEASEPDFPDIAVPNDITPALQKLATRYCTDPGAWNVFAMDIK
NEPKGKATWGKGDEDTDWNLQAAKIGNAVLKKCPRLLIFVQGVQTNIKGVSMKWGQAGGS
LQGAKDYPVKLSNMERLVYSPHLISPGVDYKAPWWGDSSFPDNMPDIWDEYFGFVPKETG
QAVVVGSWGAQMKEKNKQWAKAVSSYLEEKSIGSFYWAFNPQSADTGGFVKDDWATPIDE
RAALLELLPTTSVEDVVAIFAKCSKTCAGNGGCEGGKCVCYTGWSGPQCEICSEGDASAC
NDMGTCLRNSTCECEDDANGKYCAGTECDEVDCGDGSNAGCFNGECTCLYNCVGNSCVVC
AANDSALEDASNGATILCDACDAQTHNDFSAAQATSTVTVATAAFATLSLVLTFFYQI

Enzyme Prediction     

No EC number prediction in PITG_11993-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	36	348	2.7e-82	0.9903225806451613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.45e-31	37	356	42	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.22e-23	33	341	1	270	Cellulase (glycosyl hydrolase family 5).
411343	exchanger_TraA	5.62e-05	387	485	305	391	outer membrane exchange protein TraA. TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24085.1|GH5_1	0.0	9	501	8	500
BAU13557.1|GH5_1	9.52e-64	33	374	59	402
UAB94680.1|GH5_1	2.48e-63	20	366	53	392
AWB42992.1|CBM3|GH5_1	1.72e-62	35	356	51	371
ARV61444.1|CBM2|GH5_1	2.71e-62	33	371	64	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	1.84e-62	41	361	29	368	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	3.60e-62	41	361	29	368	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHM_A	2.01e-61	41	361	62	401	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHO_A	2.01e-61	41	361	62	401	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	2.80e-61	41	361	62	401	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.57e-58	44	356	58	369	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	9.60e-53	33	356	55	379	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	2.77e-47	42	368	44	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	2.55e-37	36	366	641	994	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|Q05332|GUNG_ACET2	9.93e-34	42	366	62	441	Endoglucanase G OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001676	0.998306	CS pos: 16-17. Pr: 0.8689

TMHMM  Annotations     

Start	End
514	536