CAZyme Information: PITG_11956-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_11956-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		34522.81	4.0452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028138:1283877-1285524(+)

Full Sequence      

MVDECVLTFVITMVCIIWSIMLAPFKCLLVSALAVSVVNGHGYLTIPKVRFTAQAGDPTQ
YIASIQASDSGFSGTFNGAPKDNVAAFTKAFKASKYTSLKEFFTDKAKIGVPVLPFDREA
CMGATTLTFYWMAMHSESWQVYVNCAPLEKTTSTGAKSKYAVGSSTSTAQSNSTSSATSD
TPSTPATEAPSAPSTPSETTAPAPPSPTDAPSTPSTDAPSTPSTDAPSTPSTDAPSTPST
DAPSTPSTPTAPTTDKSDCGSYDVAGSDSDCGSYDVAGGDDSECGSYDVAGGAESDCGSF
DVAGSGGGDATKGAGSQTSFDFSAMQQGEVNTGTVSPYK

Enzyme Prediction     

No EC number prediction in PITG_11956-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	114	236	1.1e-19	0.4122448979591837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183854	PRK13042	1.29e-10	153	240	4	92	superantigen-like protein SSL4; Reviewed.
236776	PRK10856	2.13e-08	164	241	167	250	cytoskeleton protein RodZ.
273167	rad23	5.69e-08	166	241	75	146	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
273167	rad23	3.27e-07	158	234	75	147	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
237030	kgd	5.63e-07	158	240	34	117	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY58943.1|AA17	1.33e-139	1	339	1	339
ETK81732.1|AA17	1.63e-71	23	339	3	379
ETI41704.1|AA17	2.30e-71	23	339	3	379
ETL88376.1|AA17	9.13e-71	23	339	3	379
ETN20072.1|AA17	1.29e-70	23	339	3	379

PDB Hits     

PITG_11956-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PITG_11956-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000003

TMHMM  Annotations     

Start	End
5	22