CAZyme Information: PITG_11632-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_11632-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: glycoside hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	DS028139|CGC1	40391.77	6.0305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028139:845673-846785(-)

Full Sequence      

MIESVISRKQGVLSSGAVTSTLESGVLALAIQSWLKAYGTDGDSERVANFTEYADSIVTS
ISPAFKSPEAAAKMPMDRLTIGQALLRINATEGTLTAAESETLSLLNSSLTLQNRNKYNG
FWYYVYPNWSYLDGTVSFLPYMASAPGWSYGDMLLQIELLYLNTYDKSTGLVVHGYDASK
TAVWANKVTGASPYVWGRSLGWYLAGLVNAWEELGDCHGKSNAECVRLTDAIQLQASQLC
KSIATYADKDTGVWWQLPTFGGKKGNFLESSSTMLYTFSILKGLRLGLLKDEASKLVSTA
IKAYNYTVKSGAFLLDYHNGTLGWNGTVAVCSLNSTATYEYYVGRPIVHNHALGEGAFIL
ASLEMERITN

Enzyme Prediction     

No EC number prediction in PITG_11632-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	367	2.2e-47	0.9427710843373494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.46e-29	114	367	115	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.23e-24	113	367	108	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26402.1|GH105	1.01e-189	1	367	31	400
UQC88631.1|GH105	1.65e-116	1	367	1	359
QLI72757.1|GH105	9.51e-110	1	369	15	378
QUC20491.1|GH105	1.17e-107	1	368	34	395
QPG98202.1|GH105	3.90e-107	1	367	31	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.14e-35	76	368	74	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.00e-34	114	366	123	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.22e-34	114	366	113	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	5.14e-34	114	366	123	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.17e-19	152	364	21	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.17e-19	152	364	21	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000024

TMHMM  Annotations     

There is no transmembrane helices in PITG_11632-t26_1-p1.