CAZyme Information: PITG_10999-t26_1-p1

Basic Information

• Species: Phytophthora infestans
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora infestans
• CAZyme ID: PITG_10999-t26_1-p1
• CAZy Family: GH37
• CAZyme Description: endo-1,3(4)-beta-glucanase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		83274.30	7.2776

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PinfestansT30-4	19344	403677	1547	17797

• Gene Location: location=DS028136:653003-655240(+)

Full Sequence      

MSIHQTLPSTARRPWLLLAGLCSQLLFRGDTLISAQKDSWDPHGKFPSPTLLVNATTEQS
NFCTPRHLDLMRSKPVPTNAWWGNLVTCDSTTNATGPIWSNPFALSVEDSGAYGFSLSYP
YRNRFFGGVTDGVAKYYAHPKRNEIQLTAFEFATSIPDMQVTNWTDLGVTVQLQAPSSTG
TLKSSMVSGMAYFTATYQGLTPEILFEAPIATINGASVSVGTRYSGTKFNVLAVSGQQWW
IHVYPTSSQSSGIQLNLATSMILQGLSSFDGVIRVSVILDSTQSNAQDIHSSCIVTGGDV
EITSDSKYAFKWKTDGDCSKGLFHYALDHHTKSLTAASVTEVVNASMYSATRGLMKGFVT
VASPPTWGFYESRNIPITHYPRSRLTKAAALQQDLLTKLRTDIQSIWTVATDGSYYFTGK
MVQQYASLCLMANDPVIVGTDLSLLRRCVTKLESAITPYLENSWKYKLKYDAIMGGVVSS
EGFVTGDMNADFGNTVYNDHHYHYGYWVHMASVINYLHPTWTRLGELNNMTRLLLRDVAN
PSREDPYFPKFRGFDWFRGHSYSHGMTTLGDGKDEESTSEDINLAYSMALFGQTTNHERM
KDIGRLMTKISVRSIQTYFLFDSTNTIHPAAYRSRMVPGILFDNKADYATWFSADEYMIH
GIQMLPVTPVTEYVRTSTFVQEEWDNILSKLDIVKNDELSNSWLSLLYLSYARVNKAKAL
VKLNQCTTMMNGLSRSWALYIAAQY

Enzyme Prediction     

No EC number prediction in PITG_10999-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	73	740	2.8e-166	0.9710610932475884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.87e-161	386	739	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.43e-137	64	743	78	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	4.29e-45	73	378	12	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	1.32e-242	49	745	91	792
UIZ20872.1|GH81	1.32e-242	49	745	91	792
UIZ20875.1|GH81	1.32e-242	49	745	91	792
UIZ20873.1|GH81	1.06e-241	49	745	91	792
CCA25009.1|GH81	7.85e-230	34	743	60	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	1.21e-92	18	743	19	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	1.41e-91	65	743	30	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	2.85e-88	65	743	30	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.21e-35	76	736	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.59e-20	482	720	423	655	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.14e-93	75	743	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	8.02e-84	75	739	433	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.27e-78	73	743	79	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	5.92e-78	74	743	459	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.62e-77	46	712	76	741	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012704	0.987283	CS pos: 35-36. Pr: 0.8703

TMHMM  Annotations     

There is no transmembrane helices in PITG_10999-t26_1-p1.